Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51460-AT1G51500
Species:Arabidopsis
Duplication type:TD
Function (paralog1):ABC-2 type transporter family protein
Function (paralog2):ABC-2 type transporter family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:5.916669805628
Log2 mRNA fold difference:5.8248975843643
Log2 TE fold difference:-0.033599577804876
Sequences
Protein sequence

MTTPEGAMYVAWEDLTVVIPNFGEGATKRLLNGVNGCGEPNRILAIMGPSGSGKSTLLDA
LAGRLAGNVVMSGKVLVNGKKRRLDFGAAAYVTQEDVLLGTLTVRESISYSAHLRLPSKL
TREEISDIVEATITDMGLEECSDRTIGNWHLRGISGGEKKRLSIALEVLTKPSLLFLDEP
TSGLDSASAFFVVQILRNIASSGKTVVSSIHQPSGEVFALFDDLLLLSGGETVYFGEAES
ATKFFGEAGFPCPSRRNPSDHFLRCVNSDFDNVTAALVESRRINDSSFSLHQLHETTNTL
DPLDDIPTAEIRTTLVRKFKCSLYAAASRARIQEIASIVGIVTERKKGSQTNWWKQLRIL
TQRSFINMSRDLGYYWMRIAVYIVLSICVGSIFFNVGRNHTNVMSTAACGGFMAGFMTFM
SIGGFQSFIEEMKVFSRERLNGHYGVAVYTVSNLLSSLPFIILMCLSTSSITIYMVRFQS
GGSHFFYNCLDLICAITTVESCMMMIASVVPNFLMGVMLGAGYIGIMVLSAGFFRFFPDL
PMVFWRYPVSYINYGAWALQGAYKNEMIGVEYDSPLPLVPKMKGELILQTVLGINPESSK
WLDLAVVMMILIGYRIAFFAILKFREKVFPVIHMLYTKRTLSHIQKRPSFRRMTPFPSRR
YPVHHALSSQEGLNSPLH

MELESTSNGRRPPPPAEIGRGAYLAWEDLTVVIPNFSGGPTRRLLDGLNGHAEPGRIMAI
MGPSGSGKSTLLDSLAGRLARNVIMTGNLLLNGKKARLDYGLVAYVTQEDILMGTLTVRE
TITYSAHLRLSSDLTKEEVNDIVEGTIIELGLQDCADRVIGNWHSRGVSGGERKRVSVAL
EILTRPQILFLDEPTSGLDSASAFFVIQALRNIARDGGRTVVSSIHQPSSEVFALFDDLF
LLSSGETVYFGESKFAVEFFAEAGFPCPKKRNPSDHFLRCINSDFDTVTATLKGSQRIRE
TPATSDPLMNLATSEIKARLVENYRRSVYAKSAKSRIRELASIEGHHGMEVRKGSEATWF
KQLRTLTKRSFVNMCRDIGYYWSRIVIYIVVSFCVGTIFYDVGHSYTSILARVSCGGFIT
GFMTFMSIGGFPSFIEEMKVFYKERLSGYYGVSVYIISNYVSSFPFLVAIALITGSITYN
MVKFRPGVSHWAFFCLNIFFSVSVIESLMMVVASLVPNFLMGLITGAGIIGIIMMTSGFF
RLLPDLPKVFWRYPISFMSYGSWAIQGAYKNDFLGLEFDPMFAGEPKMTGEQVINKIFGV
QVTHSKWWDLSAIVLILVCYRILFFIVLKLKERAEPALKAIQAKRTMKSLKKRPSFKKVP
SLSSLSSRRHQPLHSLSSQEGLTSPIN

Other information
Ka divergence:0.0149521KaKs divergence:-0.338474
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2037Length 2 (bp):2064Length divergence:0.007
MFE 1 (kcal):-640.8MFE 2 (kcal):-653.81MFE divergence0.01