Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51460-AT3G21090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ABC-2 type transporter family protein
Function (paralog2):ABC-2 type transporter family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.6254854255015
Log2 mRNA fold difference:0.97858218161731
Log2 TE fold difference:0.62125207572633
Sequences
Protein sequence

MTTPEGAMYVAWEDLTVVIPNFGEGATKRLLNGVNGCGEPNRILAIMGPSGSGKSTLLDA
LAGRLAGNVVMSGKVLVNGKKRRLDFGAAAYVTQEDVLLGTLTVRESISYSAHLRLPSKL
TREEISDIVEATITDMGLEECSDRTIGNWHLRGISGGEKKRLSIALEVLTKPSLLFLDEP
TSGLDSASAFFVVQILRNIASSGKTVVSSIHQPSGEVFALFDDLLLLSGGETVYFGEAES
ATKFFGEAGFPCPSRRNPSDHFLRCVNSDFDNVTAALVESRRINDSSFSLHQLHETTNTL
DPLDDIPTAEIRTTLVRKFKCSLYAAASRARIQEIASIVGIVTERKKGSQTNWWKQLRIL
TQRSFINMSRDLGYYWMRIAVYIVLSICVGSIFFNVGRNHTNVMSTAACGGFMAGFMTFM
SIGGFQSFIEEMKVFSRERLNGHYGVAVYTVSNLLSSLPFIILMCLSTSSITIYMVRFQS
GGSHFFYNCLDLICAITTVESCMMMIASVVPNFLMGVMLGAGYIGIMVLSAGFFRFFPDL
PMVFWRYPVSYINYGAWALQGAYKNEMIGVEYDSPLPLVPKMKGELILQTVLGINPESSK
WLDLAVVMMILIGYRIAFFAILKFREKVFPVIHMLYTKRTLSHIQKRPSFRRMTPFPSRR
YPVHHALSSQEGLNSPLH

MELEGSSSGRRQLPSKLEMSRGAYLAWEDLTVVIPNFSDGPTRRLLQRLNGYAEPGRIMA
IMGPSGSGKSTLLDSLAGRLARNVVMTGNLLLNGKKARLDYGLVAYVTQEDVLLGTLTVR
ETITYSAHLRLPSDMSKEEVSDIVEGTIMELGLQDCSDRVIGNWHARGVSGGERKRVSIA
LEILTRPQILFLDEPTSGLDSASAFFVIQALRNIARDGRTVISSVHQPSSEVFALFDDLF
LLSSGESVYFGEAKSAVEFFAESGFPCPKKRNPSDHFLRCINSDFDTVTATLKGSQRIQE
TPATSDPLMNLATSVIKARLVENYKRSKYAKSAKSRIRELSNIEGLEMEIRKGSEATWWK
QLRTLTARSFINMCRDVGYYWTRIISYIVVSISVGTIFYDVGYSYTSILARVSCGGFITG
FMTFMSIGGFPSFLEEMKVFYKERLSGYYGVSVYILSNYISSFPFLVAISVITGTITYNL
VKFRPGFSHYAFFCLNIFFSVSVIESLMMVVASVVPNFLMGLITGAGLIGIIMMTSGFFR
LLPDLPKIFWRYPVSYISYGSWAIQGGYKNDFLGLEFEPLFPGEPKMTGEEVIEKVFGVK
VTYSKWWDLAAVVAILVCYRLLFFVVLKLRERAGPALKAIQAKRTMRNLDRRPSFKRMPS
LSLSLSSMSSRRHQPLRSLSSQEGLNSPIHY

Other information
Ka divergence:0.173777KaKs divergence:-0.161777
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):2037Length 2 (bp):2076Length divergence:0.009
MFE 1 (kcal):-640.8MFE 2 (kcal):-666.91MFE divergence0.02