Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51470-AT1G51490
Species:Arabidopsis
Duplication type:TD
Function (paralog1):beta glucosidase 35
Function (paralog2):beta glucosidase 36

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.1008099668542
Log2 mRNA fold difference:-4.1772933477988
Log2 TE fold difference:1.0924982023655
Sequences
Protein sequence

MAIPKAHYSLAVLVLLFVVVSSSQKVCNPECKAKEPFHCDNTHAFNRSGFPKNFTFGAAT
SAYQIEGAAHRALNGWDYFTHRYPEKVPDRSSADLACDSYDLYKDDVKLLKRMNVQAYRL
SIAWSRVLPKGRLTGGVDENGITYYNNLINELKANGIEPYVTIFHWDVPQTLEDEYGGFL
STRIVEDYTNYAELLFQRFGDRVKFWITLNQPLSLALKGYGNGSYPPGRCTGCELGGDSG
VEPYTVAHNQLLAHAKTVSLYRKRYQKFQGGKIGTTLIGRWFVPLNEFSELDKAAAKRAF
DFFVGWFLDPLVYGKYPTIMREMVGDRLPEFTPEESALVKGSLDFLGLNYYVSQYATDAP
PPTQPNAITDARVTLGFYRNGSPIGVVASSFVYYPPGFRQILNYIKDNYKNPLTYITENG
VADLDLGNVTLATALADNGRIQNHCSHLSCLKCAMKDGCNVAGYFAWSLMDNYEFGNGYT
LRFGMNWVNFTNPADRKEKASGKWFSKFLAK

MQSRMQGQRTLQLRQNSCIQPKWISQKNFTFGAATSAYQVEGAAHRALNGWDYFTHRYPE
RVSDRSIGDLACNSYDLYKDDVKLLKRMNVQAYRFSIAWSRVLPKGRLIGGVDENGITYY
NNLINELKANGIEPFVTIFHWDVPQDFRRRIWRLLKPTYSDFKNYAELLFQRFGDRVKFW
ITLNQPYSLAVKGYGDGQYPPGRCTDCEFGGDSGTEPYIVGHHELLAHMEAVSLYRKRYQ
KFQGGKIGTTLIGRWFIPLNETNDLDKAAAKREFDFSVLGSTGVRTISKDNERLGDRLPK
FTPKQSALLKGSLDFLGLNYYVTRYATYRPPPMPTQHSVLTDSGVTIGFERNGVSIGVKA
SINFDVKDLRHLVDFFLFVELLLLSTRIPSDSKSHQKQELLMLIANALADNGRIQFQCSH
LSCLKCAIEDGCNVAGYFAWSLMDNYEFGNGYTLRFDMNWVNFTNPADRREKASGKWFSR
FIAK

www.000webhost.com

Other information
Ka divergence:0.387189KaKs divergence:-0.213708
GC content 1 (%):42GC content 2 (%):39GC content divergence:-0.037
Length 1 (bp):1536Length 2 (bp):1455Length divergence:-0.027
MFE 1 (kcal):-416.64MFE 2 (kcal):-384.84MFE divergence-0.04