Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51560-AT3G21140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pyridoxamine 5'-phosphate oxidase family protein
Function (paralog2):Pyridoxamine 5'-phosphate oxidase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.056420028140823
Log2 mRNA fold difference:-0.49971497688403
Log2 TE fold difference:0.51404430823369
Sequences
Protein sequence

MDAAIFTSVYVCNIPKTKKAFFNPNPPALSSSSCWLCNSQAKQIIKLRIREGSNQGLLRV
HALFNNEEASSESEDKNGFGLLPADIFSLPQEKFGSNVSGEKDSENIIDVETSLAVPHGG
GTRAGLFRTPISGGVQSATSAHGLPRPALAVRNLMEQARFAHLCTVMSKMHHRREGYPFG
SLVDFAPDPMGHPIFSFSPLAIHTRNILAEPRCTLVVQIPGWSCLSNARVTLFGDVYPLP
EEQQEWAHKQYMLKHHQGPSQQWGNFHYFRMQNISDIYFIGGFGTVAWINVNEYETLQPD
KIAVDGGEQNLKELNAIFSKPLRELLSSEAELDDAAIISIDSKGIDIRVRQGAQFKIQRL
AFEESHGVETLEEAKSALWKVIEKGKLHNLQK

MEALFTSTHTPNLQTKPLLKSPLPTSSQSSCWFCNSLPKTQFPKLRLSNGSSHGLRIQAL
LRNETPSEGEDNNGFGFFPGDIFSLSQEKLGSNSNGETSHSVIDVEASLAHPQGGGGNRA
GLFRTPISGGVQNATSAHALPRPALAVRNLLEQARFAHLCTVMSKMHHRREGYPFGSLVD
FAPDRMGHPIFLFSPLAIHTRNLLNEPRCSLVVQIPGWSGLSNARVTLFGDVYPLSEDEQ
EWAHKQYIAKHPHGPSEQWGNFHYFRMQNISDIYFIGGFGTVAWVDVKEYEGLQPDKIAV
DGGERNLKELNAIFSKPLRELLSTESEVDDAALISIDSKGIDVRVRQGAQFNIQRLAFEE
GHGVETLEEAKSALWKVLEKVKLNLQK

www.000webhost.com

Other information
Ka divergence:-0.104985KaKs divergence:0.0337917
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1179Length 2 (bp):1164Length divergence:-0.006
MFE 1 (kcal):-378.1MFE 2 (kcal):-359.9MFE divergence-0.025