Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51590-AT3G21160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha-mannosidase 1
Function (paralog2):alpha-mannosidase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.00019611679023154
Log2 mRNA fold difference:-1.0488320816365
Log2 TE fold difference:1.0259025727177
Sequences
Protein sequence

MARSRSISGYGIWKYLNPAYYLRRPRRLALLFIVFVSVSMLVWDRINLAREHEVEVFKLN
EEVSRLEQMLEELNGGVGNKPLKTLKDAPEDPVDKQRRQKVKEAMIHAWSSYEKYAWGKD
ELQPRTKDGTDSFGGLGATMVDSLDTLYIMGLDEQFQKAREWVASSLDFDKDYDASMFET
TIRVVGGLLSAYDLSGDKMFLEKAKDIADRLLPAWNTPTGIPYNIINLRNGNAHNPSWAA
GGDSILADSGTEQLEFIALSQRTGDPKYQQKVEKVITELNKNFPADGLLPIYINPDNANP
SYSTTTFGAMGDSFYEYLLKVWVQGNKTSAVKPYRDMWEKSMKGLLSLVKKSTPSSFTYI
CEKNGNNLIDKMDELACFAPGMLALGASGYGPDEEKKFLSLAGELAWTCYNFYQSTPTKL
AGENYFFTAGQDMSVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNIFQAFEKNSRVE
SGYVGLKDVNTGAKDNKMQSFFLAETLKYLYLLFSPSSVISLDEWVFNTEAHPLKIVARN
DPRKPTIALRQRKFGHQINV

MARNKLVSGSHGIWKYFNPAFYLRRPRRLALLIILFVSVSMVVWDRQSLSRDYQFEVSKL
NEEVLRLQQMLEEIKSVTEDVSVNSLKDVQEDPVDAQRMQRVKEAMVHAWSSYEKYAWGQ
DELQPQTKDGVDSFGGLGATMIDALDTLYIMGLDEQFQKAREWVASSLDFDKDYAASMFE
TTIRVVGGLLSAYDLSGDKIFLEKAMDIADRLLPAWDTQSGIPYNIINLKHGNAHNPTWA
GGDSILADSGTEQLEFIALSQRTGDPKYQQKVEKVISVLNKNFPADGLLPIYINPDTANP
SQSTITFGAMGDSFYEYLLKVWVFGNKTSAVKHYRDMWEKSMNGLLSLVKKSTPLSFTYI
CEKSGNSLIDKMDELACFAPGMLALGASGYSDPAEGKKFLTLAEELAWTCYNFYQSTPTK
LAGENYFFNSGSDMSVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNIFEAFEKNSRI
ESGYVGLKDVNTGVKDNKMQSFFLAETLKYLYLLFSPTTVIPLDEWVFNTEAHPLKIKSR
NDQVNLKQSNKVLLRKPAFRIRQRHYGRITKK

www.000webhost.com

Other information
Ka divergence:0.0621056KaKs divergence:-0.296951
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1683Length 2 (bp):1719Length divergence:0.011
MFE 1 (kcal):-480.2MFE 2 (kcal):-486.06MFE divergence0.006