Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51600-AT3G21175
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ZIM-LIKE 2
Function (paralog2):ZIM-like 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.15835231988066
Log2 mRNA fold difference:0.19338047848824
Log2 TE fold difference:-0.053655684305306
Sequences
Protein sequence

MDDLHGSNARMHIREAQDPMHVQFEHHALHHIHNGSGMVDDQADDGNAGGMSEGVETDIP
SHPGNVTDNRGEVVDRGSEQGDQLTLSFQGQVYVFDSVLPEKVQAVLLLLGGRELPQAAP
PGLGSPHQNNRVSSLPGTPQRFSIPQRLASLVRFREKRKGRNFDKKIRYTVRKEVALRMQ
RNKGQFTSAKSNNDEAASAGSSWGSNQTWAIESSEAQHQEISCRHCGIGEKSTPMMRRGP
AGPRTLCNACGLMWANKGAFRDLSKASPQTAQNLPLNKNEDANLETDHQIMITVANDISN
SQ

MDDLHGRNGRMHIGVAQNPMHVQYEDHGLHHIDNENSMMDDHADGGMDEGVETDIPSHPG
NSADNRGEVVDRGIENGDQLTLSFQGQVYVFDRVSPEKVQAVLLLLGGREVPHTLPTTLG
SPHQNNRVLGLSGTPQRLSVPQRLASLLRFREKRKGRNFDKTIRYTVRKEVALRMQRKKG
QFTSAKSSNDDSGSTGSDWGSNQSWAVEGTETQKPEVLCRHCGTSEKSTPMMRRGPDGPR
TLCNACGLMWANKGTLRDLSKVPPPQTPQHLSLNKNEDANLEADQMMEVTGDISNTQ

www.000webhost.com

Other information
Ka divergence:0.0595284KaKs divergence:-0.611926
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):909Length 2 (bp):894Length divergence:-0.008
MFE 1 (kcal):-283.74MFE 2 (kcal):-274.3MFE divergence-0.017