Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51630-AT3G21190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-fucosyltransferase family protein
Function (paralog2):O-fucosyltransferase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.11448682314556
Log2 mRNA fold difference:-0.17259636667818
Log2 TE fold difference:0.10816100614438
Sequences
Protein sequence

MGVDLRQVVAGILTITMFVMLGQMLHRDYFDAVQEKVQGDAHDIEFHGSKVAVEDGLVRA
FEAGTKGPWMEDSHELKPCWSISQSDEAVSSKGYVTFSLTNGPEYHVSQITDAVMVAKHL
GATLVLPDIRGSKPGDEMKFEDIYDVDKLIKTLESVVKVVRKLPSHVSLRDIAIVKVPTR
VAEDYIKEHIDPIFKSKGNIRVTTYFPSVNLRKSSQGAETDPVSCLAMFGSLELQPAVNE
LVESMIQRLKTHSKKSGGRFIAIDLRVEILEKKNCHETGAVGSKTCYNAQEIALFLRKLG
FDSDTTIYLTQPRWESSLNILKDIFPKTYTKEAIMPSDKKTKYLELENSEYENVIDFYIS
SRSDVFVPAIPGLFYANTVGKRIALGKPQVLVPAEISGTSGLPANYISPYISKKNHLAYS
CFC

MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAQDIEFEGSKVSVKDGLVGT
VEGSKGLWMEDNTDLTPCWPTLLSDDAVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLG
ATLVLPDIRGSKPGDERNFEDIYDADKLIKSLENVVKVVKKLPEEVSLRNMAIVKVPTRV
TEDYIKEHIDPIFKSKGNIRVASYFPSVNLRKSSQDGETDPVACLAMFGSLELQPEVNAV
AESMVERLRTHSRKSGGRFIAVDLRIDILEKKNCHTTGVVGSKTCYNAQEIALFLRKLGF
ASDTTIYLTQPRWDSSLNILKDIFPKTFTKEAIMPASKRSKYLESVSSEYENVIDFYISS
RSDVFVPAISGLFYANTVGKRIALGKPQVLVPAEISETSGLATDFISPYISKKNHLAYSC
FC

Other information
Ka divergence:-0.0954005KaKs divergence:-0.633486
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1272Length 2 (bp):1269Length divergence:-0.001
MFE 1 (kcal):-363.5MFE 2 (kcal):-357.43MFE divergence-0.008