Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51660-AT3G21220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mitogen-activated protein kinase kinase 4
Function (paralog2):MAP kinase kinase 5

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.9207282628811
Log2 mRNA fold difference:1.126717393118
Log2 TE fold difference:-0.1459152291817
Sequences
Protein sequence

MRPIQSPPGVSVPVKSRPRRRPDLTLPLPQRDVSLAVPLPLPPTSGGSGGSSGSAPSSGG
SASSTNTNSSIEAKNYSDLVRGNRIGSGAGGTVYKVIHRPSSRLYALKVIYGNHEETVRR
QICREIEILRDVNHPNVVKCHEMFDQNGEIQVLLEFMDKGSLEGAHVWKEQQLADLSRQI
LSGLAYLHSRHIVHRDIKPSNLLINSAKNVKIADFGVSRILAQTMDPCNSSVGTIAYMSP
ERINTDLNQGKYDGYAGDIWSLGVSILEFYLGRFPFPVSRQGDWASLMCAICMSQPPEAP
ATASPEFRHFISCCLQREPGKRRSAMQLLQHPFILRASPSQNRSPQNLHQLLPPPRPLSS
SSSPTT

MKPIQSPSGVASPMKNRLRKRPDLSLPLPHRDVALAVPLPLPPPSSSSSAPASSSAISTN
ISAAKSLSELERVNRIGSGAGGTVYKVIHTPTSRPFALKVIYGNHEDTVRRQICREIEIL
RSVDHPNVVKCHDMFDHNGEIQVLLEFMDQGSLEGAHIWQEQELADLSRQILSGLAYLHR
RHIVHRDIKPSNLLINSAKNVKIADFGVSRILAQTMDPCNSSVGTIAYMSPERINTDLNH
GRYDGYAGDVWSLGVSILEFYLGRFPFAVSRQGDWASLMCAICMSQPPEAPATASQEFRH
FVSCCLQSDPPKRWSAQQLLQHPFILKATGGPNLRQMLPPPRPLPSAS

www.000webhost.com

Other information
Ka divergence:-0.0983978KaKs divergence:-0.307544
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1101Length 2 (bp):1047Length divergence:-0.025
MFE 1 (kcal):-347.6MFE 2 (kcal):-304.63MFE divergence-0.066