Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51680-AT3G21240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):4-coumarate:CoA ligase 1
Function (paralog2):4-coumarate:CoA ligase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.0942531544079
Log2 mRNA fold difference:-2.2884560850464
Log2 TE fold difference:0.176776712852
Sequences
Protein sequence

MAPQEQAVSQVMEKQSNNNNSDVIFRSKLPDIYIPNHLSLHDYIFQNISEFATKPCLING
PTGHVYTYSDVHVISRQIAANFHKLGVNQNDVVMLLLPNCPEFVLSFLAASFRGATATAA
NPFFTPAEIAKQAKASNTKLIITEARYVDKIKPLQNDDGVVIVCIDDNESVPIPEGCLRF
TELTQSTTEASEVIDSVEISPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENP
NLYFHSDDVILCVLPMFHIYALNSIMLCGLRVGAAILIMPKFEINLLLELIQRCKVTVAP
MVPPIVLAIAKSSETEKYDLSSIRVVKSGAAPLGKELEDAVNAKFPNAKLGQGYGMTEAG
PVLAMSLGFAKEPFPVKSGACGTVVRNAEMKIVDPDTGDSLSRNQPGEICIRGHQIMKGY
LNNPAATAETIDKDGWLHTGDIGLIDDDDELFIVDRLKELIKYKGFQVAPAELEALLIGH
PDITDVAVVAMKEEAAGEVPVAFVVKSKDSELSEDDVKQFVSKQVVFYKRINKVFFTESI
PKAPSGKILRKDLRAKLANGL

MTTQDVIVNDQNDQKQCSNDVIFRSRLPDIYIPNHLPLHDYIFENISEFAAKPCLINGPT
GEVYTYADVHVTSRKLAAGLHNLGVKQHDVVMILLPNSPEVVLTFLAASFIGAITTSANP
FFTPAEISKQAKASAAKLIVTQSRYVDKIKNLQNDGVLIVTTDSDAIPENCLRFSELTQS
EEPRVDSIPEKISPEDVVALPFSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYFNRD
DVILCVLPMFHIYALNSIMLCSLRVGATILIMPKFEITLLLEQIQRCKVTVAMVVPPIVL
AIAKSPETEKYDLSSVRMVKSGAAPLGKELEDAISAKFPNAKLGQGYGMTEAGPVLAMSL
GFAKEPFPVKSGACGTVVRNAEMKILDPDTGDSLPRNKPGEICIRGNQIMKGYLNDPLAT
ASTIDKDGWLHTGDVGFIDDDDELFIVDRLKELIKYKGFQVAPAELESLLIGHPEINDVA
VVAMKEEDAGEVPVAFVVRSKDSNISEDEIKQFVSKQVVFYKRINKVFFTDSIPKAPSGK
ILRKDLRARLANGLMN

Other information
Ka divergence:-0.266986KaKs divergence:-0.716265
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1686Length 2 (bp):1671Length divergence:-0.004
MFE 1 (kcal):-524.35MFE 2 (kcal):-501.67MFE divergence-0.022