Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51700-AT3G21270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DOF zinc finger protein 1
Function (paralog2):DOF zinc finger protein 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.54251615276005
Log2 mRNA fold difference:-0.71738100667499
Log2 TE fold difference:0.20870743228782
Sequences
Protein sequence

MQDLTSAAAYYHQSMMMTTAKQNQPELPEQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFC
KNCRRYWTKGGALRNIPVGGGTRKSNKRSGSSPSSNLKNQTVAEKPDHHGSGSEEKEERV
SGQEMNPTRMLYGLPVGDPNGASFSSLLASNMQMGGLVYESGSRWLPGMDLGLGSVRRSD
DTWTDLAMNRMEKN

MQDPAAYYQTMMAKQQQQQQPQFAEQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCR
RYWTKGGALRNVPVGGGSRKNATKRSTSSSSSASSPSNSSQNKKTKNPDPDPDPRNSQKP
DLDPTRMLYGFPIGDQDVKGMEIGGSFSSLLANNMQLGLGGGGIMLDGSGWDHPGMGLGL
RRTEPGNNNNNPWTDLAMNRAEKN

Other information
Ka divergence:-0.478807KaKs divergence:-0.199056
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):585Length 2 (bp):615Length divergence:0.025
MFE 1 (kcal):-175MFE 2 (kcal):-186.61MFE divergence0.032