Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51710-AT3G21280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin-specific protease 6
Function (paralog2):ubiquitin-specific protease 7

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.4566491248705
Log2 mRNA fold difference:-2.1413712561489
Log2 TE fold difference:0.67457951935178
Sequences
Protein sequence

MPTVSVKWQKKVLDGIEIDVSLPPYVFKAQLYDLTGVPPERQKIMVKGGLLKDDGDWAAI
GVKDGQKLMMMGTADEIVKAPEKAIVFAEDLPEEALATNLGYSAGLVNLGNTCYMNSTVQ
CLKSVPELKSALSNYSLAARSNDVDQTSHMLTVATRELFGELDRSVNAVSPSQFWMVLRK
KYPQFSQLQNGMHMQQDAEECWTQLLYTLSQSLKAPTSSEGADAVKALFGVNLQSRLHCQ
ESGEESSETESVYSLKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYVKESLIDSL
PRYLTVQFVRFFWKRESNQKAKILRKVDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGK
KLGLQTSAKSGSKDSDVKMTDAEASANGSGESSTVNPQEGTSSEKETHMTGIYDLVAVLT
HKGRSADSGHYVAWVKQESGKWIQYDDDNPSMQREEDITKLSGGGDWHMAYITMYKARFV
SM

MVIKPDPNQPGSTHPVRILAYIETKKEEEGKFFFFDIACLGFKKEINLVSLQHQTMLTVS
VKWQKKVFESIEIDTSQPPFVFKAQLYDLSGVPPERQKIMVKGGLLKDDADWSTLGLKNG
QKLMMMGTADEIVKAPEKGPVFMEDLPEEQQAANLGYSAGLVNLGNTCYMNSTMQCLISV
PELKSELSNYQSARTKDVDQTSHMLTVATRELFSELDKSVKAVAPMPFWMVLQKKYPQFA
QLHNGNHMQQDAEECWTQMLYTLSQSLKLPSPSEDPDAVKALFGLNLLNRLHCQESSEES
SETESVFSLKCHISHEVNHLHEGLKHGLKGELEKTSPSLGRTAVYVKESLIDSLPRYLTV
QFVRFFWKRESNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDIEGQKLGLQA
SAKSSSKGDDVKMTDAEGSSNQSGESSTGDQQEGASPHMTGIYDLVSVLTHKGRSADSGH
YVAWVKQESGKWVQYDDANTSLQRGEDIIKLSGGGDWHMAYIVMYKARLISM

Other information
Ka divergence:-0.127112KaKs divergence:0.0910129
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1449Length 2 (bp):1599Length divergence:0.049
MFE 1 (kcal):-447.22MFE 2 (kcal):-510.84MFE divergence0.066