Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51760-AT1G51780
Species:Arabidopsis
Duplication type:TD
Function (paralog1):peptidase M20/M25/M40 family protein
Function (paralog2):IAA-leucine resistant (ILR)-like gene 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.1310796582711
Log2 mRNA fold difference:-2.9675085570086
Log2 TE fold difference:0.58130559288958
Sequences
Protein sequence

MSFFKWVSFVLILHLLNPTLISCSSNGLSQIPSKFLTLAKRNDFFDWMVGIRRRIHENPE
LGYEEVETSKLVRAELEKMGVSYKYPVAVTGVVGYVGTGHAPFVALRADMDALAMQEMVE
WEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEHEEELQGTVVLVFQPAEEGGGGAKKIVE
AGVLENVSAIFGLHVTNQLALGQVSSREGPMLAGSGFFKAKISGKGGHAALPQHTIDPIL
AASNVIVSLQHLVSREADPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFMQL
KKRIEQVITRQASVNMCNATVDFIEEEKPFFPPTVNDKALHQFFKNVSGDMLGIENYVEM
QPLMGSEDFSFYQQAIPGHFSFVGMQNKARSPMASPHSPYFEVNEELLPYGASLHASMAT
RYLLELKASTLNKSNKKDEL

MSFCKLVSFVLILHLLNSCLISCSSNDLSQIPKNFLSLAKREDFFDWMVGIRRRIHENPE
LGYEEVETSKLVKTELDKMGVSYKNPVAVTGVIGYVGTGHAPFVALRADMDALPIQEMVE
WEHKSKIPGKMHACGHDAHTTMLLGAAKLLKEHQEELQGTVILVFQPAEEGGAGAKKIVE
AGVLENVGAIFGLHVSNLLGLGQLSSREGLLMAGSGRFKATISGKGGHAALPQFAIDPVL
AASNVILSLQHLVSREADPLDSQVVTVATFEGSDAFNVIPDSVTIGGTFRALLPKSFEQL
KQRIVQVITTQASVNMCNATVDFLEDETPPFPPTVNNKTLHLFYKNVSVDMLGIENYVET
LPVMVSEDFAFYQQAIPGHFSFVGMQNKSHSPMANPHSPFFEVNEELLPYGASLLASLAT
RYLLDSSSSPNKDEL

Other information
Ka divergence:0.448539KaKs divergence:0.0419669
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1323Length 2 (bp):1308Length divergence:-0.006
MFE 1 (kcal):-389.1MFE 2 (kcal):-366.13MFE divergence-0.03