Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51950-AT3G16500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):indole-3-acetic acid inducible 18
Function (paralog2):phytochrome-associated protein 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.70872788301258
Log2 mRNA fold difference:0.045094238937085
Log2 TE fold difference:0.33757590847362
Sequences
Protein sequence

MEGYSRNGEISPKLLDLMIPQERRNWFHDEKNSVFKTEEKKLELKLGPPGEEDDDESMIR
HMKKEPKDKSILSLAGKYFSPSSTKTTSHKRTAPGPVVGWPPVRSFRKNLASGSSSKLGN
DSTTSNGVTLKNQKCDAAAKTTEPKRQGGMFVKINMYGVPIGRKVDLSAHNSYEQLSFTV
DKLFRGLLAAQRDFPSSIEDEKPITGLLDGNGEYTLTYEDNEGDKMLVGDVPWQMFVSSV
KRLRVIKTSEISSALTYGNGKQEKMRR

MEGCPRNREIGPKLLDLIPQGRKWYQEDKNNTDQEKKLELRLGPPGGDEEDHSAIKKKNT
EIRNIKKETEDKSFHCFNGNHFSPSNKTTSVPHISQKRTAPGPVVGWPPVRSFRKNLAST
SSSKLGNESSHGGQINKSDDGEKQVETKKEGMFVKINMDGVPIGRKVDLNAYNSYEQLSF
VVDKLFRGLLAAQRDISDGQGEEKPIIGLLDGKGEFTLTYEDNEGDKMLVGDVPWQMFVS
SVKRLRVIKSSEISSALTFGCSKQEKMMH

www.000webhost.com

Other information
Ka divergence:0.0401713KaKs divergence:0.104568
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):804Length 2 (bp):810Length divergence:0.004
MFE 1 (kcal):-214.48MFE 2 (kcal):-216.02MFE divergence0.004