Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51980-AT3G16480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Insulinase (Peptidase family M16) protein
Function (paralog2):mitochondrial processing peptidase alpha subunit

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.6744099658897
Log2 mRNA fold difference:-2.2189264646105
Log2 TE fold difference:0.59046187209596
Sequences
Protein sequence

MYRTAASRARALKGVLTRSLRPARYASSSAVAETSSSTPAYLSWLSGGSRAALTSLDMPL
QGVSLPPPLADKVEPSKLQITTLPNGLKIASETTPNPAASIGLYVDCGSIYEAPYFHGAT
HLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLIDS
VRNPAFLDWEVNEELRKMKVEIAELAKNPMGFLLEAIHSAGYSGPLASPLYAPESALDRL
NGELLEEFMTENFTAARMVLAASGVEHEELLKVAEPLTSDLPNVPPQLAPKSQYVGGDFR
QHTGGEATHFAVAFEVPGWNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLN
EYQEVQSCTAFTSIFNDTGLFGIYGCSSPQFAAKAIELAAKELKDVAGGKVNQAHLDRAK
AATKSAVLMNLESRMIAAEDIGRQILTYGERKPVDQFLKSVDQLTLKDIADFTSKVISKP
LTMGSFGDVLAVPSYDTISSKFR

MYRTAASRAKALKGILNHNFRASRYASSSAVATSSSSSSWLSGGYSSSLPSMNIPLAGVS
LPPPLSDHVEPSKLKTTTLPNGLTIATEMSPNPAASIGLYVDCGSIYETPQFRGATHLLE
RMAFKSTLNRSHFRLVREIEAIGGNTSASASREQMGYTIDALKTYVPEMVEVLIDSVRNP
AFLDWEVNEELRKVKVEIGEFATNPMGFLLEAVHSAGYSGALANPLYAPESAITGLTGEV
LENFVFENYTASRMVLAASGVDHEELLKVVEPLLSDLPNVPRPAEPKSQYVGGDFRQHTG
GEATHFALAFEVPGWNNEKEAIIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRLLNQHQQ
FQSCTAFTSVFNNTGLFGIYGCTSPEFASQGIELVASEMNAVADGKVNQKHLDRAKAATK
SAILMNLESRMIAAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADFTSKVITKPLTMA
TFGDVLNVPSYDSVSKRFR

Other information
Ka divergence:-0.113643KaKs divergence:0.0594126
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1512Length 2 (bp):1500Length divergence:-0.004
MFE 1 (kcal):-497.11MFE 2 (kcal):-445.86MFE divergence-0.054