Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52140-AT3G16330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2035114801999
Log2 mRNA fold difference:0.26196205072535
Log2 TE fold difference:-1.4675845868836
Sequences
Protein sequence

MDQNVPISKKLWNIVRFLLYMIRKGVSKNKLIADFNATLKRGKNLMFHQRRRVHAGSTAS
AALNATSATASSRQEYEFSCSNTPNYSFPFSNMAFMRKKSHNNLFTCGQTPQTLDDDVAA
ARAVLELLNGVGEKGNVTPADLTVALSPYFPGFGQTPLVRPLRVTDSPFPLTPENGDVAN
GHVDKAADDFIKKFYKNLNQQKKMIEFS

MEKNISISKKLGNIVRFVLYMLHKGISKQKLLADFNATLKRGKNLMFHNRRRVPGSAVAS
HPQNEYEFSCSDTPNYTFPFNMAAFKKKSHHNSLFSCGQAPPTLDDDTSVSRAVLELLNS
GGDHDQGSNTPAFSIEALTALSPYLPGFGRSTSSVRPLRVTDSPFPLREEGDVANGHVDK
AADEFIKKFYKNLYQQKKMIESSPN

www.000webhost.com

Other information
Ka divergence:-0.121363KaKs divergence:-0.572822
GC content 1 (%):46GC content 2 (%):49GC content divergence:0.032
Length 1 (bp):627Length 2 (bp):618Length divergence:-0.007
MFE 1 (kcal):-191.2MFE 2 (kcal):-194.2MFE divergence0.008