Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52160-AT3G16260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):tRNAse Z3
Function (paralog2):tRNAse Z4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.0814406613454
Log2 mRNA fold difference:0.74599972861208
Log2 TE fold difference:0.32676368716627
Sequences
Protein sequence

MINSMPYLHKNLRLLRLLSSKSSPFPLSLRPFSPRSFSLSTLFSSSSSSSSMENNEATNG
SKSSSNSFVFNKRRAEGFDITDKKKRNLERKSQKLNPTNTIAYAQILGTGMDTQDTSSSV
LLFFDKQRFIFNAGEGLQRFCTEHKIKLSKIDHVFLSRVCSETAGGLPGLLLTLAGIGEE
GLSVNVWGPSDLNYLVDAMKSFIPRAAMVHTRSFGPSSTPDPIVLVNDEVVKISAIILKP
CHSEEDSGNKSGDLSVVYVCELPEILGKFDLEKAKKVFGVKPGPKYSRLQSGESVKSDER
DITVHPSDVMGPSLPGPIVLLVDCPTESHAAELFSLKSLESYYSSPDEQTIGAKFVNCII
HLSPSSVTSSPTYQSWMKKFHLTQHILAGHQRKNMAFPILKASSRIAARLNYLCPQFFPA
PGFWPSQLTDNSIIDPTPSNKCSSSNLAESISAENLLKFNLRPVAIRGIDRSCIPAPLTS
SEVVDELLSEIPEIKDKSEEIKQFWNKQHNKTIIEKLWLSECNTVLPNCLEKIRRDDMEI
VILGTGSSQPSKYRNVSAIFIDLFSRGSLLLDCGEGTLGQLKRRYGLDGADEAVRKLRCI
WISHIHADHHTGLARILALRSKLLKGVTHEPVIVVGPRPLKRFLDAYQRLEDLDMEFLDC
RSTTATSWASLESGGEAEGSLFTQGSPMQSVFKRSDISMDNSSVLLCLKNLKKVLSEIGL
NDLISFPVVHCPQAYGVVIKAAERVNSVGEQILGWKMVYSGDSRPCPETVEASRDATILI
HEATFEDALIEEALAKNHSTTKEAIDVGSAANVYRIVLTHFSQRYPKIPVIDESHMHNTC
IAFDLMSINMADLHVLPKVLPYFKTLFRDEMVEDEDADDVAMDDLKEEAL

MLTSSMPQNLSLFGFSPLKSSSFALILRPFSLYPPIFASSSPAPSRRPPRTAGYRRSGPS
PPRRKWSSFEEQKRKGRSPMEKDKAISFNHSSDSFEFNKRRAEGLDKVDKPKKNLKRNTR
TLNPTNTIAYVQILGTGMDTQDTSPSVLLFFDKQRFIFNAGEGLQRFCTEHKIKLSKVDH
IFLSRVCSETAGGLPGLLLTLAGIGEQGLSVNVWGPSDLKYLVDAMRSFIPRAAMVHTRS
FGPSLNISDSAPQIGLSKPKDDAYVLVDDEVVKISAILLEPSRLEESGSKPGETAVIYVC
ELPEIKGKFDPKKAMALGLRAGPKYSYLQSGQSVKSDFKDITVHPSDVMGPSVPGPVVLL
VDCPTESHAEELLSIPSMKTYYSCLDNSTDGAKLVNCIIHLSPASVTNSSTYRSWMKRFH
SAQHILAGHEAKNMEFPILRASSRITARLNYLCPQFFPAPGFWSHQHDNNSINPTSLSKC
FDSNLGESISAENLLKFTLRPHGNLGVDRSSIPSRLTALRVMDELLSEIPEISSKTEEIK
QLWNGQHNKMMIEEPWLGESTVPSCLENIRRDDMEIVLLGTGSSQPSKYRNVTAIYIDLF
SRGSILLDCGEGTLGQLKRRYGLEGADEAVRNLRCIWISHIHADHHTGLARILARRRELL
KGLAHEPAIVVGPRSLKNFLDAYQRLEDLDMEFLDCRNTTTTSWASVETSRPEKNTSSGN
AEGSLFSKGSLMQSIYKRPSSPLTDNSSALPFLKKLKKVLGEMGLEHLISFPVVHCPQAF
GVSLKAAERKNIAGDEIPGWKMVYSGDTRPCPEMVEASKGATVLIHEATFEDALVEEAVA
KNHSTTKEAIKVGSSAGVYRTVLTHFSQRYPKIPVIDESHMHNTCIAFDMMSINMADLHV
LPKILPYFKTLFRNQVVEEEEEEEETDDDSLIRDKVPSFFIN

www.000webhost.com

Other information
Ka divergence:-0.172826KaKs divergence:0.0614209
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):2673Length 2 (bp):2829Length divergence:0.028
MFE 1 (kcal):-755.41MFE 2 (kcal):-836.27MFE divergence0.051