Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52190-AT3G16180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.3596895659547
Log2 mRNA fold difference:-2.3669590654116
Log2 TE fold difference:0.095114965305141
Sequences
Protein sequence

MENPPNETEAKQIQTNEGKKTKGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFG
VAKGTNVLFMWSAASNFTPLLGAFLSDSYLGRFLTISIASLSSFLGMVLLWLTAMLPQVK
PSPCDPTAAGSHCGSSTASQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNER
VLESFFGWYYASSAVAVLIAFTGIVYIQEHLGWKIGFGVPAVLMLIAALLFILASPLYVT
RGVTKSLFTGLAQAIVAAYKKRKLSLPDHHDSFDCYYHMKDSEIKAPSQKLRFLNKACLI
SNREEEIGSDGFALNPWRLCTTDKVEELKALIKVIPIWSTGIMMSINTSQSSFQLLQATS
MDRRLSRHGSSFQVPAGSFGMFTIIALALWVILYDRAVIPLASKIRGRPFRLSVKLRMGL
GLFMSFLAMAISAMVESFRRKKAISQGYANNSNAVVDISAMWLVPQYVLHGLAEALTAIG
QTEFFYTEFPKSMSSIAASLFGLGMAVASLLASVVLNAVNELTSRNGKESWVSDNINKGH
YNYYYWVLAIMSFINVIYYVICSWSYGPLVDQVRNGRVNGVREEEELIDIVGKGFEKEDL
SPVVKTN

MENPPDQTESKETLQQPITRRRTKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYR
LGLVKGQTVLFMWVAATNFMPLVGAFLSDSYLGRFLTIVIASLSSLLGMVVLWLTAMLPQ
VKPSPCVATAGTNCSSATSSQLALLYTAFALISIGSGGIRPCSLAFGADQLDNKENPKNE
RVLESFFGWYYASSSVAVLIAFTVIVYIQDHLGWKIGFGIPAILMLLAGFLFVFASPLYV
KRDVSKSLFTGLAQVVAAAYVKRNLTLPDHHDSRDCYYRLKDSELKAPSDKLRFLNKACA
ISNRDEDLGSDGLALNQWRLCTTDQVEKLKALVKVIPVWSTGIMMSINVSQNSFQLLQAK
SMDRRLSSNSTFQIPAGSFGMFTIIALISWVVLYDRAILPLASKIRGRPVRVNVKIRMGL
GLFISFLAMAVSATVEHYRRKTAISQGLANDANSTVSISAMWLVPQYVLHGLAEALTGIG
QTEFFYTEFPKSMSSIAASLFGLGMAVANILASVILNAVKNSSKQGNVSWIEDNINKGHY
DYYYWVLAILSFVNVIYYVVCSWSYGPTVDQVRNDKVNGMRKEEEEVIKLN

www.000webhost.com

Other information
Ka divergence:0.12709KaKs divergence:0.122188
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1824Length 2 (bp):1776Length divergence:-0.013
MFE 1 (kcal):-565.22MFE 2 (kcal):-551.09MFE divergence-0.013