Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52230-AT3G16140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):photosystem I subunit H2
Function (paralog2):photosystem I subunit H-1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.065769428072946
Log2 mRNA fold difference:-0.51977290297739
Log2 TE fold difference:0.62112820636668
Sequences
Protein sequence

MASFATIAAVQPSAAVKGLGGSSLAGAKLFIKPSRQSFKTKSTRAGAVVAKYGDKSVYFD
LEDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSA
NSTGDVLPIKRGPQEPPKLGPRGKL

MASLATVAAVKPSAAIKGLGGSSLAGAKLSIKPSRLSFKPKSIRANGVVAKYGDKSVYFD
LEDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSA
TSTGEVLPIKRGPQEPPKLGPRGKL

Other information
Ka divergence:0.140507KaKs divergence:0.530612
GC content 1 (%):46GC content 2 (%):52GC content divergence:0.061
Length 1 (bp):438Length 2 (bp):438Length divergence:0
MFE 1 (kcal):-134.6MFE 2 (kcal):-138.16MFE divergence0.013