Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52240-AT3G16130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RHO guanyl-nucleotide exchange factor 11
Function (paralog2):RHO guanyl-nucleotide exchange factor 13

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.016887053677354
Log2 mRNA fold difference:0.59014604774134
Log2 TE fold difference:-0.27558350004774
Sequences
Protein sequence

MLEGKAMVEDSDMPVKMQMQAMAFASQALDLFDVFDCKSIAGHIKKEFDERYGSGWQCVA
LLLLNYTTLIMGMPKLREEVDFNDNMNENSASRHVKSWSSDCAMRMDGSDNLDDDDNDMM
MFRSQPGKCGSVDRPSLPIGGVTPNRNDKLPRVSSSDSMEALIILQAAMEQMKEKFSKLL
LGEDMSGGGKGVSSALALSNAITNLAASAFGEQRRLEPMAVDRKTRWRREIGWLISVADY
IVEFAPTQQTNKDGTSMEVMSTRQRTDLLCNIPALKKLDAMLLDCLDKFKDQDEFYYVKK
DSPDSCETRNDEKWWLPAVKVPPNGLSEISRRFLQSQKECVNQVLKAAMAINAQVLSEME
IPESYLESLPKNGRASLGDVIYRMITVEMFDADQFLIEMDLSSEHKILDLKNRIEASIVI
WKRKMVQKDTKSPWGSTVSIEKREQFEERAETILLLLKQGFPGISQSSLDISKIQFNRDV
GLAILESYSRVLESLAHTVMSRIEDVLYADQLTQEPTNNAPSKNRYSLKENEKLREERLS
FTEDMASGTLSDVMQWGNKNNEMKKESFFGDREKPLLSKVTGIMTNNKKSSYLDNLGAMR
SPTARYS

MVKASEKEHEKYKPKLFDLENVKKKNSSSRHFKRWNSDSALRIEDPDIDDGTVFKKTATS
SIQPILPVLAMDEQPQPREATDEESQKDSGKREIISFLGYNEKFTRDQVILRFRGLQAKS
CYFAYVTELEQMKDKFAKLLLGEDMSGGSKGVSSALALSNAITNLAASAFGEIRRLEAIS
EDKKERWRREIGWLLSVTDHIVEFSPTHQTNEDGSSMEVMTTKQRTDLVSNIPSLKKLDE
MLLDCLDKFKDQDEFYYVTPGSPESENSNSTRNDDKWWLPIVKVPPKGLSETLKRFLLSQ
RECVCQVLNSAMAINSQVLTEMEIPESYIDSLPKKGRASLGDMIYRMITLEMFDAEQFLL
EMDLSSEHKILDLKNKFEASVVIWQRKIVQIDNKSSSPWSTNLSMDKRQQLEERAATILQ
LIKQEFPGISQSTLDISKIQFNRDIGLAIVESYSRILESLAHTVMSRIEDVLEADQLTQN
PELAMCKIHIVKETESPEKEEEPNFCLLEDRPKKQKPTISLSEVMQWNIETNEPRKEKSD
KKLLTRVSSMIMSNNKKTTYLESLGTTRSPTAGRYS

Other information
Ka divergence:0.394948KaKs divergence:0.0624537
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):1824Length 2 (bp):1731Length divergence:-0.026
MFE 1 (kcal):-531.03MFE 2 (kcal):-463.25MFE divergence-0.068