Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52260-AT3G16110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PDI-like 1-5
Function (paralog2):PDI-like 1-6

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.65011249248326
Log2 mRNA fold difference:0.865596175783
Log2 TE fold difference:-0.24600950244449
Sequences
Protein sequence

MSLIPKPISKVSTFTFILLILLSFTIIIAYSSPDSNVESNEPGFDSDLDQLLAVDEQLQE
DRPEQQSEAETVSKAQRIVLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAA
TALKEIGSSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQ
KKTGAPIITLNTVDEAPRFLDKYHTFVLGLFEKFEGSEHNEFVKAAKSDDEIQFIETRDS
DVAKLLFPDLKSNNVFIGLVKPEAERYTVYDGSYKMEKILEFLGSNKFPLFTKLTETNTV
WVYSSPVKLQVMLFSKADDFQKLAQPLEDIARKFKSKLMFIYVDITNENLAMPFLILFGI
EAGNKTVVAAFDNNLNSKYLLESDPSPNSIEEFCSGLAHGTVSRYYRSEPVPDNENASIV
TVVGKTFDGLVLNSRENVLLEVHTPWCVNCEALSKQIEKLAKHFKGFENLVFARIDASAN
EHTKLQVDDKYPIILLYKSGEKEKPLKLSTKLSAKDIAVFINEELLKPKNGSAKDEL

MLTKPKPNSKFSILFTFLLLLSFLIFVARSSDVAVEAGSEEELDDLEQLLAVDEQLQEER
PEQQSEAETVSKAQRIVVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATD
LKEIGSSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKK
TGASTIKLDTVDEASGFLKKHHTFILGLFEKSEDSSGHDEFVKAASLDNEIQFVETSSID
VAKLLFPNLKTNNVFVGLVKTEAEKYTSYDGPCQAEKIVEFLNSNKFPLVTKLTESNTVR
VYSSPVKLQVMVFSKTDDFESLAQPLEDIARKFKSKLMLIYIDISNENLAMPFLTLFGIE
DAKKTVVAAFDNNLNSKYLLESDPSPSNIEEFCFGLAHGTVSAYYKSQPIPDNQNASVVA
VVGRTFDEVVLRSSENVLLEVHTPWCINCEALSKQVEKLSQHFKGFENLVFARIDASANE
HPKLTVDDYPTILLYKTGEKENPLKLSTKSSAKDMAVLINKELKWKDQSGKDEL

Other information
Ka divergence:-0.154887KaKs divergence:-0.0264817
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):1614Length 2 (bp):1605Length divergence:-0.003
MFE 1 (kcal):-448.08MFE 2 (kcal):-466.14MFE divergence0.02