Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52280-AT3G16100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RAB GTPase homolog G3D
Function (paralog2):RAB GTPase homolog G3C

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.089273879614513
Log2 mRNA fold difference:1.4258482805558
Log2 TE fold difference:-1.4558679200777
Sequences
Protein sequence

MSSRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQ
IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF
VVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAAFECITKNAFKNE
PEEEPYLPDTIDVAGGQQQRSTGCEC

MASRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQ
IWDTAGQERFQSLGVAFYRGADCCVLVNDVNVMKSFENLNNWREEFLIQASPSDPENFPF
VVLGNKTDVDGGKSRVVTEKKAKSWCASKGNIPYFETSAKDGVNVDAAFECIAKNALKNE
PEEEVYLPDTIDVAGARQQRSTGCEC

Other information
Ka divergence:0.432095KaKs divergence:0.713293
GC content 1 (%):40GC content 2 (%):44GC content divergence:0.048
Length 1 (bp):621Length 2 (bp):621Length divergence:0
MFE 1 (kcal):-175.6MFE 2 (kcal):-191MFE divergence0.042