Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52300-AT3G16080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc-binding ribosomal protein family protein
Function (paralog2):Zinc-binding ribosomal protein family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.098188040484
Log2 mRNA fold difference:-1.2127769481582
Log2 TE fold difference:0.11882285441105
Sequences
Protein sequence

MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG
TGRMRYLRNVPRRFKTGFREGTEAKPRNKGVASSA

MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG
TGRMRYLRNVPRRFKTGFREGTEAKPRSKASASSA

www.000webhost.com

Other information
Ka divergence:-0.478855KaKs divergence:0.182028
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):288Length 2 (bp):288Length divergence:0
MFE 1 (kcal):-83.2MFE 2 (kcal):-91.6MFE divergence0.048