Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52360-AT3G15980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Coatomer, beta' subunit
Function (paralog2):Coatomer, beta' subunit

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.80726990678297
Log2 mRNA fold difference:-0.43163996675699
Log2 TE fold difference:-0.35023336021526
Sequences
Protein sequence

MFLFDLSNLIRIFACRWREFECSLMTFFCVELSNDHGCCILRRSEPLRLEIKRKLAQRSE
RVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEVTELPVRSAKFVARKQWVVAGA
DDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWACTQ
IFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTG
GDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIW
HATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLGREIPVASMDNTGKIIW
AKHNEIQTANIKSIGADYEVTDGERLPLSVKELGTCDLYPQSLKHNPNGRFVVVCGDGEY
IIYTALAWRNRSFGSGLEFVWSSEGECAVRESSSKIKIFSKNFQEKRSIRPTFSAEKIFG
GTLLAMCSSDFICFYDWAECRLIQRIDVTVKNLYWADSGDLVAIASDTSFYILKFNRDLV
TSHFDSGRPTEEEGVEDAFEVLHENDERVRTGIWVGDCFIYNNSSWKLNYCVGGEVTTMY
HLDRPMYLLGYLASQSRVFLVDKEFNVIGYTLLLSLIEYKTLVMRGDLDKASEILPTIPK
DQHNSVAHFLESRGMIEDALEIATDPDYRFELAIQLGRLEIAQEIAVEVQSESKWKQLGE
LAMSSGKLQMAEECMKYAMDLSGLLLLYSSLGDAEGVTKLATLAKEQGKNNVAFLCLFML
GKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVALWRKDLSKVNSKAAESLADPEEYS
NLFEDWQVALSVEAKAVETRGVYTGAKDYPSHADKSSMTLVEAFRNLQVEEEESLENGDM
DHEEVVAEENGNEQRNEDDVAEHVEEHHEEKEAEEEEGIVDGDSTDGAVLVNGSEADEEW
GTNNEGNPSA

MPLRLDIKRKFAQRSERVKSVDLHPTEPWILASLYSGTVCIWNYQTQTITKSFEVTELPV
RSAKFIPRKQWVVAGADDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDD
MLIKLWDWENGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLGSPDPNFT
LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLDGHTHNVSAVCFHPE
LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLG
REIPVASMDSSGKIIWAKHNEIQTANIKSIGAGYELSSLYLRLLMEKDFPCLLKSWGPVI
FIHNYSNSQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSGLEFVWSSEGECAVRES
SSKIKIFSKNFQERKSIRPTFSAEKIFGGTLLAMCSNDFICFYDWAECRLIQQIDVTVKN
LYWAESGDLVAIASDTSFYILKYNRELVSSHFDSGRPTDEEGVEDAFEVLHENDERVRTG
IWVGDCFIYNNSSWKLNYCVGGEVTTMYHLDRPMYLLGYIANQSRVYLVDKEFNVIGYTL
LLSLIEYKTLVMRGDLDRANQILPTIPKEQHNNVAHFLESRGMIEDALEIATDPDYKFDL
AIQLGRLEIAKEIAEEVQSESKWKQLGELAMSSGKLQLAEDCMKYAMDLSGLLLLYSSLG
DAEGVSKLACLAKEQGKNNVAFLCLFTLGRLEDCLQLLVESNRIPEAALMARSYLPSKVS
EIVALWREDLSKVNPKAAESLADPEEYSNLFEDWQVALSVEANTAETRGVYTAAENYPSH
ADKPSITLVEAFRNLQVEAEESLENGNIDHEVAEENGHVENEGDEEEQQEEEVNEEEGVV
DADSTDGAVLVNGSEGEEEWGTNNKGNPSA

Other information
Ka divergence:0.295886KaKs divergence:0.318635
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2913Length 2 (bp):2793Length divergence:-0.021
MFE 1 (kcal):-884.45MFE 2 (kcal):-860.37MFE divergence-0.014