Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52380-AT3G15970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NUP50 (Nucleoporin 50 kDa) protein
Function (paralog2):NUP50 (Nucleoporin 50 kDa) protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.96933409521431
Log2 mRNA fold difference:-0.48260290228016
Log2 TE fold difference:-0.48281651914649
Sequences
Protein sequence

MGDSENVQQPSKKRGALKQLSRDNPGLDDDDDSAELESGTFKKASDEVLASRRIVRVKRK
EPSAAPVAASNPFAGIQLVPTTAPASTPVGTNAPLAESKLAPAEAVVEDNQKASDIEEGD
EVDSKKVDVKDAVGEETEKTKDKDDNHCGKSADVQVAATEVAQMVSCDTNVCNNAVEGTD
QTDFPLEKDSGGDQAEKKEKEGNGIEEADKNGDNGAFSSFQQHSSNKNAFTGLASTEASG
SSFSFGLVSQDGSTGTGSLFGFGLPSSNSSSIFGATGSSIIKKSEGSGFPPKQEVSTETG
EENEKVAFSADSIMFEYLDGGWKERGKGELKVNVSSNDGKARLVMRAKGNYRLILNASLY
PEMKLANMDKKGITFACVNSVSEGKEGLSTFALKFKDPTIVEEFRVAIDKHKDSKPMEKA
AEKSALPLKTPENSPTATDT

MGDSDNAIPFSRKRTALKELSRDNPGLDDDDEDTSALESGTFNTASKEVLASRRIIRVRR
TDRSATAPPASNPFTGIRLVPFTAPAPSTAAAETTKPLSAGKQETLADGRSDATKETDGD
SKEKSDAIDAVGKQETQGDEISAKTKDIIDGGEKEMSEAVNSVEGGGAVNKNEDEIKTTM
VTEVAAGEETVKDDNNNSNTVEGSDCVVKDTGGNQTEKEGKEGDGNEDTEKNGDSGALSS
FHQHSSSKNAFTGLASTGFSASSFSFGLVPQEGSTGSGSEQSSFSFGQANNGNSSLFGAS
VATSITTKSTETTTAFPSKQDVSVETGEENEKAAFTADSVMFEYLEGGWKERGKGELKVN
ISTTENRKARLVMRSKGNYRLTLNASLYPEMKLAKMDKKGITFACVNSVSDAKDGLSTLA
LKFKDPTVVEEFRAVIEEHKDSKPSVAEAAAPLKTPENSPSAEDA

www.000webhost.com

Other information
Ka divergence:0.02843KaKs divergence:-0.242581
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1323Length 2 (bp):1398Length divergence:0.028
MFE 1 (kcal):-396.37MFE 2 (kcal):-406.87MFE divergence0.013