Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52420-AT3G15940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-Glycosyltransferase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.2446893788541
Log2 mRNA fold difference:-1.6358334310023
Log2 TE fold difference:0.38988669769567
Sequences
Protein sequence

MEEIRLSPLRQTSVKSSLSGRSTPRGTPRVYSGRTPRRGHGGGGAFQWFRSSRLVYWLLL
ITLWTYLGFYVQSRWAHDNESKVEFLRFGGRPRKDELYMEKIKGLDVVANENSEALVNIT
GKDDAGSNKRTDVSLIKKDDGVSRRSLSSKQKTRKTVRTSRSKIRVKQKVIKEVLETKDL
DDEQDPQLPLTNATYGKLLGPFGSLEDKVLEWSPHRRSGTCDRKSDFKRLVWSRRFVLLF
HELSMTGAPISMMELASELLSCGATVSAVVLSRRGGLMQELSRRRIKVVEDKGELSFKTA
MKADLIIAGSAVCTSWIDQYMNHHPAGGSQIAWWIMENRREYFDRAKPVLDRVKMLIFLS
ESQSRQWLTWCEEEHIKLRSQPVIVPLSVNDELAFVAGIPSSLNTPTLSPEKMRVKRQIL
RESVRTELGITDSDMLVMSLSSINPTKGQLLLLESIALALSERGQESQRNHKGIIRKEKV
SLSSKHRLRGSSRQMKSVSLTLDNGLRREKQELKVLLGSVGSKSNKVGYVKEMLSFLSNS
GNLSKSVMWTPATTRVASLYSAADVYVTNSQGVGETFGRVTIEAMAYGLAVVGTDAGGTK
EMVQHNMTGLLHSMGRSGNKELAHNLLYLLRNPDERLRLGSEGRKMVEKMYMKQHMYKRF
VDVLVKCMRP

MEDLRLSPLKLGSFKSSLSGRSTPRGSPTLRKVHSGRTPRREGKGSGGAVQWFRSNRLLY
WLLLITLWTYLGFYVQSRWAHDDDNKVEFLRFGGKLREDVLHVEQNKRRDLVADESSHAV
VDHTNIVHLGVNKRMHVTLAKKEDSTSRRSVSPRRRTRKASRSSRTRIRSTQKVRKVMET
KELDEQDQELPNINVTYGKLFGPFGSLEDRILEWSPQKRSGTCDRKSDFKRLVWSRRFVL
LFHELSMTGAPISMMELASELLSCGATVYAVVLSRRGGLLQELTRRRIKVVEDKGELSFK
TAMKADLVIAGSAVCASWIDQYMDHHPAGGSQIAWWVMENRREYFDRAKPVLDRVKLLIF
LSEVQSKQWLTWCEEDHVKLRSQPVIVPLSVNDELAFVAGVSSSLNTPTLTQETMKEKRQ
KLRESVRTEFGLTDKDMLVMSLSSINPGKGQLLLLESVALALEREQTQEQVAKRNQSKII
KNLNGIRKEKISLSARHRLRGSSRKMKITSPAVDNHPSVLSATGRRKLLLSGNVTQKQDL
KLLLGSVGSKSNKVAYVKEMLSFLSNNGNLSNSVLWTPATTRVASLYSAADVYVTNSQGV
GETFGRVTIEAMAYGLPVLGTDAGGTKEIVEHNVTGLLHPVGRAGNKVLAQNLLFLLRNP
STRLQLGSQGREIVEKMYMKQHMYKRFVDVLVKCMRP

Other information
Ka divergence:-0.253314KaKs divergence:-0.12039
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2013Length 2 (bp):2094Length divergence:0.02
MFE 1 (kcal):-621.01MFE 2 (kcal):-676.32MFE divergence0.043