Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52540-AT3G15890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.4802409285423
Log2 mRNA fold difference:-0.83638126369029
Log2 TE fold difference:-0.60179270490141
Sequences
Protein sequence

MQIFSCFCCGKGFDRQKKVKTEPSWRIFSLKELHAATNSFNYDNKLGEGRFGSVYWGQLW
DGSQIAVKRLKAWSSREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYDYMPNLS
LVSHLHGQHSSESLLDWTRRMNIAVSSAQAIAYLHHFATPRIVHGDVRASNVLLDSEFEA
RVTDFGYDKLMPDDGANKSTKGNNIGYLSPECIESGKESDMGDVYSFGVLLLELVTGKRP
TERVNLTTKRGITEWVLPLVYERKFGEIVDQRLNGKYVEEELKRIVLVGLMCAQRESEKR
PTMSEVVEMLMIESKEKMAQLEANPLFNGNNDGEVIDESSEIISEVRDHQ

MQLLNSCCGKGFDGKKKEKEEPSWRVFSLKELHAATNSFNYDNKLGEGRFGSVYWGQLWD
GSQIAVKRLKEWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYEYMQNLSL
VSHLHGQHSAECLLDWTKRMKIAISSAQAIAYLHDHATPHIVHGDVRASNVLLDSEFEAR
VTDFGYGKLMPDDDTGDGATKAKSNNGYISPECDASGKESETSDVYSFGILLMVLVSGKR
PLERLNPTTTRCITEWVLPLVYERNFGEIVDKRLSEEHVAEKLKKVVLVGLMCAQTDPDK
RPTMSEVVEMLVNESKEKISELEANPLFKNPYSSNENNREHVAEESSDVILEDKDHQQQQ
E

Other information
Ka divergence:0.179401KaKs divergence:0.49256
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1053Length 2 (bp):1086Length divergence:0.015
MFE 1 (kcal):-315.1MFE 2 (kcal):-315.93MFE divergence0.001