Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52600-AT3G15710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peptidase S24/S26A/S26B/S26C family protein
Function (paralog2):Peptidase S24/S26A/S26B/S26C family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.26539328706273
Log2 mRNA fold difference:0.14417238500769
Log2 TE fold difference:-0.44056033119786
Sequences
Protein sequence

MGWIGETVDSIKSIQIRQLFTQAISLGMIVTSALIIWKALMCVTGSESPVVVVLSGSMEP
GFKRGDILFLHMSKDPIRAGEIVVFNVDGRDIPIVHRVIKVHERENTGEVDVLTKGDNNY
GDDRLLYAEGQLWLHRHHIMGRAVGFLPYVGWVTIIMTEKPIIKYILIGALGLLVITSKD

MGFIGETVDSIKSIKIRQVLTQAITLGMIVTSALIIWKALICVTGSESPVVVVLSESMEP
GFQRGDILFLRMTDEPIRAGEIVVFSVDGREIPIVHRAIKVHERGDTKAVDVLTKGDNND
IDDIGLYAEGQLWLHRHHIMGRAVGFLPYVGWVTIIMTEKPIIKYILIGALGLLVITSKD

Other information
Ka divergence:0.456093KaKs divergence:-0.726519
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):543Length 2 (bp):543Length divergence:0
MFE 1 (kcal):-155.16MFE 2 (kcal):-153.6MFE divergence-0.005