Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52670-AT3G15690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Single hybrid motif superfamily protein
Function (paralog2):Single hybrid motif superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.021393020304419
Log2 mRNA fold difference:0.13031599843079
Log2 TE fold difference:-0.14882811425681
Sequences
Protein sequence

MNSCSLGAPKVRIFATNFSRLRCGNLLIPNNQRLFVDQSPMKYLSLRTTLRSVKAIQLST
VPPAETEAIADVKDSDETKSTVVNTHLMPKSSEVEALISEITDSSSIAEFELKLGGFRLY
VARKLTDESSPPPQQIQPVVAASATPEGVHTNGSATSSSLAITKTSSSSADRPQTLANKA
ADQGLVILQSPTVGYFRRSKTIKGKRTPTICKEKDIVKEGQVLCYIEQLGGQIPVESDVS
GEIVKILREDGEPVGYNDALITVLPSFPGIKKLQ

MASCSLGVPKIKISAVDLSRVRSGSLLIPYNQRSLLRQRPVKYLSLKTTFGSVKAVQVST
VPTAETSATIEVKDSKEIKSSRLNAQLVPKPSEVEALVTEICDSSSIAEFELKLGGFRLY
VARNIADNSSLQPPPTPAVTASNATTESPESNGSASSTSLAISKPASSAADQGLMILQSP
KVGFFRRSKTIKGKRLPSSCKEKDQVKEGQILCYIEQLGGQFPIESDVTGEVVKILREDG
EPVGYNDALISILPSFPGIKKLQ

Other information
Ka divergence:-0.116437KaKs divergence:0.200506
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):825Length 2 (bp):792Length divergence:-0.02
MFE 1 (kcal):-215.25MFE 2 (kcal):-226.2MFE divergence0.025