Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52690-AT3G15670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Late embryogenesis abundant protein (LEA) family protein
Function (paralog2):Late embryogenesis abundant protein (LEA) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.60779363127667
Log2 mRNA fold difference:-0.21526570893255
Log2 TE fold difference:0.80592344692062
Sequences
Protein sequence

MASHQEQSYKAGETRGKAQEKTGEAMGTMGDKTQAAKDKTQETAQSAQQKAHETAQSAKD
KTSQAAQTTQERAQESKDKTGSYMSETGEAIKNKAHDAAEYTKETAEAGKEKTSGILGQT
GEQVKQMAMGATDAVKHTLGLRTDEGNKEHVSSAPSTTTTTTTRETQRK

MASNQQSYKAGETRGKAQEKTGQAMGTMRDKAEEGRDKTSQTAQTAQQKAHETAQSAKDK
TSQTAQAAQQKAHETAQSAKEKTSQTAQTAQQKAHETTQAAKEKTSQAGDKAREAKDKAG
SYLSETGEAIKNKAQDAAQYTKETAQGAAQYTKETAEAGRDKTGGFLSQTGEHVKQMAMG
AADAVKHTFGMATEEEDKEHYPGSTTTTTATTRTTDPTHQTYQRK

Other information
Ka divergence:-0.382522KaKs divergence:-0.703254
GC content 1 (%):48GC content 2 (%):52GC content divergence:0.04
Length 1 (bp):510Length 2 (bp):678Length divergence:0.141
MFE 1 (kcal):-135.3MFE 2 (kcal):-208.9MFE divergence0.214