Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52700-AT3G15650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:3.0977804030201
Log2 mRNA fold difference:1.8318793108925
Log2 TE fold difference:1.2032825365437
Sequences
Protein sequence

MSYSHQSMGSGSRNARGYEFGRTYVVRPKGKHQATLVWLHGLGDNGSSSSQLMDSLHLPN
IKWICPTAPSRPVTSLGGFTCTAWFDVGEISEDGHDDLEGLDASASHIANLLSSEPADVK
VGIGGFSMGAAISLYSATCYALGRYGTGHAYPINLQAVVGLSGWLPGWKSLRSKIECSFE
AARRAASLPIILTHGTSDDVVPYRFGEKSAQSLGMAGFRLAMFKPYEGLGHYTVPREMDE
VVHWLTTMLGLEGSR

MSYSRQSMGSGSRSTRGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSRILACSLITTSHF
GSVSFCSSSQLLESLPLPNIKWICPTAPSRPVSLLGGFPCTAWFDVGEISEDLHDDIEGL
DASAAHIANLLSAEPTDVKVGIGGFSMGAAIALYSTTCYALGRYGTGHAYTINLRATVGL
SGWLPGWRSLRSKIESSNEVARRAASIPILLAHGTSDDVVPYRFGEKSAHSLAMAGFRQT
MFKPYEGLGHYTVPKEMDEVVHWLVSRLGLEGSR

www.000webhost.com

Other information
Ka divergence:-0.213565KaKs divergence:0.59757
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):768Length 2 (bp):825Length divergence:0.036
MFE 1 (kcal):-239.7MFE 2 (kcal):-252.91MFE divergence0.027