Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52720-AT3G15630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0971145529195
Log2 mRNA fold difference:-0.16256355975354
Log2 TE fold difference:-1.3150199791682
Sequences
Protein sequence

MALIITCSALPTIRASSGSGSLNPDQNRKKSAAWWAPLFGLPSDPDYLNIESSCSTVNPD
KTDISGSGQKFRRGCFTEEKAKQLRRKTAEASTFHDVMYHSAIASRLASDITGRVED

MATIISCSALSSIRASSESDPARKKPVSSVSWWAPLFGMSSEPDYVNKTVNLESDLDKAE
KRSLRCCLTEEKAKQLRRKTAEASTFHDVMYHSAIASRLASDVRVKK

Other information
Ka divergence:0.316051KaKs divergence:0.482
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):354Length 2 (bp):324Length divergence:-0.044
MFE 1 (kcal):-112.4MFE 2 (kcal):-102.8MFE divergence-0.045