Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52730-AT3G15610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.0978406646785
Log2 mRNA fold difference:1.1129739332438
Log2 TE fold difference:-1.0337837338137
Sequences
Protein sequence

MEKKKVTIPQVCHGHSRPVVDLFYSPITPDGFFLISASKDSHPMLRNGETGDWIGTFEGH
KGAVWSSCLDNNALRAASASADFSAKLWDALTGDVLHSFEHKHIVRACAFSEDTKSLLTG
GFEKILRVFDMNRLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKI
VQTLETKSPVTSAEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSG
EKFVAGGEDMWVRVFDFYTGEEIGCNKGHHGPVHCVRFTPTGLSYASGSEDGTIRIWQTT
PANPEENETSSRRVKHSVDEVSKKIEGFHINKEGKTAEKPSDT

MEKKKVATPLVCHGHSRPVVDLFYSPITPDGFFLISASKDSQPMLRNGETGDWIGTFEGH
KGAVWSSCLDNNALRAASASADFSAKLWDALTGDVLHSFEHKHIVRACAFSQDTKYLITG
GFEKILRVFDLNRLDAPPTEIDKSPGSIRTLTWLHGDQTILSSCTDIGGVRLWDVRSGKI
VQTLETKSPVTSAEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSG
NKFVAGGEDMWVRLFDFHTGKEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTG
PVNPEEISESKPKQSVDEVARKIEGFHINKEGKTAEKPSDA

Other information
Ka divergence:0.0524231KaKs divergence:0.0637423
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1032Length 2 (bp):1026Length divergence:-0.003
MFE 1 (kcal):-297.4MFE 2 (kcal):-326.1MFE divergence0.046