Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52770-AT3G15570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phototropic-responsive NPH3 family protein
Function (paralog2):Phototropic-responsive NPH3 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.3859400804368
Log2 mRNA fold difference:2.4466060220275
Log2 TE fold difference:-0.17340921085325
Sequences
Protein sequence

MDKTSSPESATISTKSPSTSTGKMECSWFDDGCILGIDYFVKTIAGIKSKGVRPDLIGSI
IVHYASQWLPDLSDIVLNSDDQQPQPQQQSESFSVTAFVMKKRSFVETLIGIIPPERDSV
PCDFLLRLLRTANMVGADANYKAELEARISWQLDQASLKELMIPSFSHTCGTLLDVELMT
RLVKKFAGLDNEGVKSGASLIKVAKLVDSYLAEAALDGDLTLSEFISLVEALPNHARVTE
DGLYRAIDTYLKAHPNVTKQERKRLCGLIDSNKLSMEASLHAAQNDRLPVRTIIQVLFSE
QAKLSHRSHNNIEWSGSSFSGVRSSPNPSGSHYSDSGPARCTSKREINVQQAEIRRLRED
MAKLKCECEAMQTQLHKLVEKKGTCTSGNKGFFRWKKLGFRSGLSVSVVENTNGEEFGNN
GEGENFEYVTQTPGNMMTKLVKGRTPSRWRKSMS

MKKTLSPEPVTIYGNRQETFVGDMEYYTYFDESCIQDMNYFVKTITGIKSKGIRPDLIGS
IIAHYASKWLPDLSGNVSAIISSTSLESKNNHNDTQPESVTASVMKKRFFVETLIGILPP
EKDSVPCNFLLRLLRTAKMVGANPNYLTELETRVSWQLDQASLKELMIPSFSYTSGTLLD
IELVTRLVNKFSGLDSEGVKTAAALVKVAKLVDSYLAEAAVDGGLALPEFISLITALPSH
ARTTEDGLYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIG
VLFTEQTKLSRHIDCNSSSISSTTRSPTNASGSHYLEGGSAARCLSKREMNVQQAEIRRL
REDVVRLQSQCGAMHFQLERLMEKKSSGGSKGFFRWKRLGLVPSIRGSVSVEKGEEESGD
NGEGFEPRTPGNMKTRLVKGRTTPSRWRKSMS

Other information
Ka divergence:0.00226169KaKs divergence:-0.202194
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1365Length 2 (bp):1359Length divergence:-0.002
MFE 1 (kcal):-428.4MFE 2 (kcal):-431.63MFE divergence0.004