Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52830-AT3G15540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):indole-3-acetic acid 6
Function (paralog2):indole-3-acetic acid inducible 19

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.4290064575733
Log2 mRNA fold difference:2.1215792250074
Log2 TE fold difference:-0.59051601481482
Sequences
Protein sequence

MAKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVE
DESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINL
VTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSD
ATGFGLQQD

MEKEGLGLEITELRLGLPGRDVAEKMMKKRAFTEMNMTSSGSNSDQCESGVVSSGGDAEK
VNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSSQGY
DDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRLRIM
KRSDATGFGLQPRGVDE

Other information
Ka divergence:-0.36299KaKs divergence:0.480647
GC content 1 (%):44GC content 2 (%):50GC content divergence:0.064
Length 1 (bp):570Length 2 (bp):594Length divergence:0.021
MFE 1 (kcal):-162.83MFE 2 (kcal):-195.54MFE divergence0.091