Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52880-AT3G15510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
Function (paralog2):NAC domain containing protein 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.5752907659003
Log2 mRNA fold difference:2.8149212690676
Log2 TE fold difference:-0.21122929786266
Sequences
Protein sequence

MESTDSSGGPPPPQPNLPPGFRFHPTDEELVIHYLKRKADSVPLPVAIIADVDLYKFDPW
ELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVISTGGGGSKKVGV
KKALVFYSGKPPKGVKSDWIMHEYRLTDNKPTHICDFGNKKNSLRLDDWVLCRIYKKNNS
TASRHHHHLHHIHLDNDHHRHDMMIDDDRFRHVPPGLHFPAIFSDNNDPTAIYDGGGGGY
GGGSYSMNHCFASGSKQEQLFPPVMMMTSLNQDSGIGSSSSPSKRFNGGGVGDCSTSMAA
TPLMQNQGGIYQLPGLNWYS

MESTDSSGGPPPPQPNLPPGFRFHPTDEELVVHYLKRKAASAPLPVAIIAEVDLYKFDPW
ELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLASDGNQKVGVKK
ALVFYSGKPPKGVKSDWIMHEYRLIENKPNNRPPGCDFGNKKNSLRLDDWVLCRIYKKNN
ASRHVDNDKDHDMIDYIFRKIPPSLSMAAASTGLHQHHHNVSRSMNFFPGKFSGGGYGIF
SDGGNTSIYDGGGMINNIGTDSVDHDNNADVVGLNHASSSGPMMMANLKRTLPVPYWPVA
DEEQDASPSKRFHGVGGGGGDCSNMSSSMMEETPPLMQQQGGVLGDGLFRTTSYQLPGLN
WYSS

Other information
Ka divergence:-0.10391KaKs divergence:-0.0474074
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):963Length 2 (bp):1095Length divergence:0.064
MFE 1 (kcal):-303.22MFE 2 (kcal):-342.29MFE divergence0.061