Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52910-AT3G15480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1218)
Function (paralog2):Protein of unknown function (DUF1218)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.9030941419667
Log2 mRNA fold difference:2.4160548146218
Log2 TE fold difference:0.46578498223168
Sequences
Protein sequence

MASKLVIIIVFILDLIAVGLAIAAEQRRSVGKVVPDGEKEFEHCEYGSDIATSYGAGAFV
LLFISQVIIMVASRCFCCGKALKPGGSRACGIMLFLICWVFFLIAEVCLLAGSIRNAYHT
TYRRMWNIENPPSCEVIRKGVFAAGASFALFTAIVSQFYYISYSRARDGYQTPHY

MASKLVVIIVFILDLIAVGLAIAAEQRRSVGKVETDRDKQYDYCVYGTDIATSYGAGAFV
LLFVSQVLIMAASRCFCCGKSLNPGGSRACAIILFLICWVFFLIAEMCLLAASIRNAYHT
QYRKMWKVEDPPSCEVIRKGVFAAGAAFTLFTAIVSQFYYVCYSRARDAYQNPSY

Other information
Ka divergence:-0.138765KaKs divergence:0.222222
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):528Length 2 (bp):528Length divergence:0
MFE 1 (kcal):-156.8MFE 2 (kcal):-144.69MFE divergence-0.04