Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G52930-AT3G15460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal RNA processing Brix domain protein
Function (paralog2):Ribosomal RNA processing Brix domain protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3221457324698
Log2 mRNA fold difference:-1.2757473716513
Log2 TE fold difference:-0.24630130910417
Sequences
Protein sequence

MGRKRKHSETEAPAPVKKSDEPAPDRPKRTLLGWKDKSEGEAEKAKALTSSGFKNKEKVL
VTCSRRISFRYRSLMLNIVSLLPHCKKDSKVEAKSSKGATLNELIELKNSNSCLFFECRK
HKDLYMWMVKSPNGPSVKFLVKAVHAMEEMKLTGNHLKGSRPLLTFSSNFDKDAHWKLLK
EMLTQVFGIPKEHRKSKPYHDHVFVFSIVDEHIWFRNYQISVPHNESDKIAKGGLDKMTL
IEVGPRFCLNPIKIFAGSFGGPTLYENPLYVSPNQIRALEKRNKAGKFAKKIKAKTRKKM
HELSNPLEPDEFADMWKDDE

MGRKRKHSETVTAAPVKDSAPERPQRTLLGWKDKKEDAENSKPAYASVFRNKEKVLVTCS
RRINFRYRHLMLNMVSLLPHCKKDSKVEAKSSRGATLNELIELKGSSSCLFFECRKHKDL
YMWMVKSPGGPSVKFLVNAVHTMEELKLTGNHLKGSRPLLTFSSNFENDAHWKLLKEMLT
QIFGIPEGHRKSKPYHDHVFVFSIVDDHIWFRNYQISVPHNESDKIARGDLDKMTLIEVG
PRFCLNPIKIFGGSFGGTTLYENPFYVSPNQIRALEKRNKAGKFAKKIKAKTRRKMHELS
NPLEPDEFTDMWNDE

www.000webhost.com

Other information
Ka divergence:0.0571525KaKs divergence:-0.0517529
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):963Length 2 (bp):948Length divergence:-0.008
MFE 1 (kcal):-282.8MFE 2 (kcal):-271.76MFE divergence-0.02