Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53030-AT3G15352
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cytochrome C oxidase copper chaperone (COX17)
Function (paralog2):cytochrome c oxidase 17

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.7107111091627
Log2 mRNA fold difference:0.1459372142829
Log2 TE fold difference:1.6166140943964
Sequences
Protein sequence

MSGLQAQDSACSLDKPSKDVVATETKPKKRICCACPDTKKLRDECIVEHGESACTKWIEA
HILCLRSEGFKV

MTDQPAQNGLIPPPTSEPSKAAASAETKPKKRICCACPDTKKLRDECIVEHGESACTKWI
EAHKICLRAEGFNV

www.000webhost.com

Other information
Ka divergence:0.0659184KaKs divergence:-0.733333
GC content 1 (%):41GC content 2 (%):48GC content divergence:0.079
Length 1 (bp):219Length 2 (bp):225Length divergence:0.014
MFE 1 (kcal):-59.6MFE 2 (kcal):-62.3MFE divergence0.022