Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53160-AT3G15270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):squamosa promoter binding protein-like 4
Function (paralog2):squamosa promoter binding protein-like 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.5278148207585
Log2 mRNA fold difference:-1.117584230236
Log2 TE fold difference:-0.42879320412131
Sequences
Protein sequence

MEGKRSQGQGYMKKKSYLVEEDMETDTDEEEEVGRDRVRGSRGSINRGGSLRLCQVDRCT
ADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEAKRSCRRRLAG
HNERRRKSSGESTYGEGSGRRGINGQVVMQNQERSRVEMTLPMPNSSFKRPQIR

MEGQRTQRRGYLKDKATVSNLVEEEMENGMDGEEEDGGDEDKRKKVMERVRGPSTDRVPS
RLCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAK
RSCRRRLAGHNERRRKISGDSFGEGSGRRGFSGQLIQTQERNRVDRKLPMTNSSFKRPQI
R

Other information
Ka divergence:0.0644693KaKs divergence:0.999753
GC content 1 (%):44GC content 2 (%):48GC content divergence:0.043
Length 1 (bp):525Length 2 (bp):546Length divergence:0.02
MFE 1 (kcal):-134.84MFE 2 (kcal):-164.71MFE divergence0.1