Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53165-AT3G15220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0040551532115
Log2 mRNA fold difference:2.5260515753415
Log2 TE fold difference:-2.6520815937859
Sequences
Protein sequence

MDDVAGLQEAAGTRFSQFELIGRGSFGDVYKAFDTELNKDVAIKVIDLEESEDEIEDIQK
EISVLSQCRCPYITEYYGSYLHQTKLWIIMEYMAGGSVADLLQPGNPLDEISIACITRDL
LHAVEYLHAEGKIHRDIKAANILLSENGDVKVADFGVSAQLTRTISRRKTFVGTPFWMAP
EVIQNSEGYNEKADIWSLGITMIEMAKGEPPLADLHPMRVLFIIPRESPPQLDEHFSRPL
KEFVSFCLKKAPAERPNAKELLKHRFIKNARKSPKLLERIRERPKYQVKEDEEIPTNGPK
APAESSGTVRVAKDERGQGTSGTRLDKWLDKCFQVKTVRNAGWDFSIGGSQGAGTVRALK
PPQARERRQEVNSNQTSQKTSRTSGSQLSSTFGVPEISEGGFNKRDSYQNDYQEEDDSSG
SGTVVIRSPRSSQSSSMFRDQSSGSTRYTSFDDASTSGTVVVRGQNDDSGSPRTPRSRLG
LQERSSSASEDSISNLAEAKLALEAGFRRGNARERLGNGKVNKRREQATDNSDYLRNSRD
HSDKQRPVMRSQQVSDDEEDDSKLASLSASLSLLLLPSLKEAVGGDDSKGTIGHRVSRSL
VKMEREKPGSSEAFIAKLIEQLGSTKEVSVKEVQDMAIRVFAKTMNNDAENKRKQASKEF
SSNANFSPLARFLFSRWLGQTSRDLNQS

MDDVAGLQEAAGARFSQIELIGRGSFGDVYKAFDKDLNKEVAIKVIDLEESEDEIEDIQK
EISVLSQCRCPYITEYYGSYLHQTKLWIIMEYMAGGSVADLLQSNNPLDETSIACITRDL
LHAVEYLHNEGKIHRDIKAANILLSENGDVKVADFGVSAQLTRTISRRKTFVGTPFWMAP
EVIQNSEGYNEKADIWSLGITVIEMAKGEPPLADLHPMRVLFIIPRETPPQLDEHFSRQV
KEFVSLCLKKAPAERPSAKELIKHRFIKNARKSPKLLERIRERPKYQVKEDEETPRNGAK
APVESSGTVRIARDERSQGAPGYSFQGNTVKNAGWDFTVGGSQSIGTVRALKPPQARERR
QEVSPNRISQRTTRPSGNQWSSATGSTISEASEGGFVRRHPFQNDHEDGFHEEDDSSLSG
SGTVVIRTPRSSQSSSVFREPSSGSSGRYAAFDDASASGTVVVRGQYDDSGSPRTPKSRL
GIQERTSSASEDSNANLAEAKAALDAGFRRGKARERLGMGNNNNDGKVNRRREQMADDSD
YSRNSGDKSSKQKVVPRSEQVSDEEDDSIWESLPASLSVLLIPSLKEALGDDSKESTVRT
VSRSLVMMEREKPGSCEAFVAKLIELLGSSKEASVKELHDMAVCVFAKTTPDNAENKMKQ
ANKEFSSNTNVSPLGRFLLSRWLGQSSRDL

Other information
Ka divergence:0.0809732KaKs divergence:0.106547
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):2067Length 2 (bp):2073Length divergence:0.001
MFE 1 (kcal):-606.78MFE 2 (kcal):-605.73MFE divergence-0.001