Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53170-AT3G15210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ethylene response factor 8
Function (paralog2):ethylene responsive element binding factor 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.4648573024756
Log2 mRNA fold difference:3.4619516106158
Log2 TE fold difference:0.18041234806086
Sequences
Protein sequence

MPNITMGLKPDPVAPTNPTHHESNAAKEIRYRGVRKRPWGRYAAEIRDPVKKTRVWLGTF
DTAQQAARAYDAAARDFRGVKAKTNFGVIVGSSPTQSSTVVDSPTAARFITPPHLELSLG
GGGACRRKIPLVHPVYYYNMATYPKMTTCGVQSESETSSVVDFEGGAGKISPPLDLDLNL
APPAE

MAKMGLKPDPATTNQTHNNAKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEA
ARAYDTAARDFRGAKAKTNFPTFLELSDQKVPTGFARSPSQSSTLDCASPPTLVVPSATA
GNVPPQLELSLGGGGGGSCYQIPMSRPVYFLDLMGIGNVGRGQPPPVTSAFRSPVVHVAT
KMACGAQSDSDSSSVVDFEGGMEKRSQLLDLDLNLPPPSEQA

Other information
Ka divergence:-0.39646KaKs divergence:0.450604
GC content 1 (%):54GC content 2 (%):56GC content divergence:0.018
Length 1 (bp):558Length 2 (bp):669Length divergence:0.09
MFE 1 (kcal):-194.5MFE 2 (kcal):-255.3MFE divergence0.135