Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53180-AT3G15115
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.079831696343031
Log2 mRNA fold difference:-0.04557592943588
Log2 TE fold difference:-0.024647630423245
Sequences
Protein sequence

MDHVSSSELLIDDLLEDYWFFENLFTRRSRGLRYCHSDPYPSSSSTSTSPEKMGDSDIGK
VLEASTGRSLIRASSIDSREGGSQTKLTGRFSEKIRVQEQRQVGSSLQKKEHVVLPKSGS
RSAPGKIQEASTKRGLIRAPSLPPQIEKREMDREAKKMINKLTRQFSEKIRVLEPTRPGE
HFLQKKETIARDKGITESSRSNKTGSSSSYSSVKISLQRTQTMPNNMGREEDNEEDEFED
QESDSRMGFLIREALASSHYVPKVSNNQRQRPPRSLRLEDTAMVKQGGSSPKTLRKTLSS
VETTKEIQRLKGYDQLVEPRVASGLATPPRVPKDSSKEMKDQIKFWARAVATNVRQEC

MDSTSNDHQELEQFEAIDDLLEDFWFFDNLLDRRSRILRYCHSDPYPFTSSSSSTCPKPE
LPKIGDSDSEIKLLEASTGGDFVPPPCIEKKEGGGEPEKINKVMRRQFSEKTRVQERRTY
LQKKEPVVREKGIKEGSRKKNRTRISCSNNNSVQSCSMGGSLQRTQTLPSYLGREDDVNE
FQDQEIDDSRMGFLIREAIANSSSSSSSGFTPTKQNIPKVSCIPRHRPPRNSRSEDAIQE
LVVKSQKSPNRKTLRKTLSSIETKDIQMLKDFHIETEKKQEEDEEKQRKVPCTTTGKNRS
TAVVGQPIPVWVPKDSRKDMKAQIKFWARTVASNVRQEC

www.000webhost.com

Other information
Ka divergence:-0.0233432KaKs divergence:-0.118161
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1077Length 2 (bp):1020Length divergence:-0.027
MFE 1 (kcal):-316.92MFE 2 (kcal):-292.85MFE divergence-0.039