Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53190-AT3G15070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.66546639261577
Log2 mRNA fold difference:0.3102500520658
Log2 TE fold difference:0.38000350950838
Sequences
Protein sequence

MGQRNRNVDLEMEQQQSQASLQAEPCILLGSFPQQPDNNNMPAMVAHVPNLEPHSLQDPT
YDNSAMFYGLPQYHHHPHQRVPTNFYVPYVAFQAPPGQLPSSSSHGVVGVSPDHEYERNA
HFMDHTRGTYKRKNAEGIPGQPQYLSTLAAPFNTPETIAPFGGARNRPGAVTVNTVLPSH
APNNFIQGNYAGHHPFPPPGSMWYDQHHGRSDGSPSFWPTPYMHGSNIFAGSIESSSRNP
TSFMYPSQLNPRDHYYSHHHHPAPPPVQGMRGQNATLYPHTASSASYRVPPGSFTPQNTM
NSGPLGSEMGSSHMGPVQPTGFRIYQHHQRDDSVPVATLRQHRGGVPRLRVMPDDEVALL
EFGDFLGGSGNNHIDHHRDMRLDIEEMSYEELLALSERIGTVNTGLPEEDVKNHLKTRTC
SGINFEKESSSPRTKDLETEPCTICQESFKNEEKIATLDCGHEYHAECLEKWLIVKNVCP
ICKSEALVMEKRKV

MRQRNMMTGSDMEQNSQSFVPHPEPRIGTNYLYPDIPPVNTVPHLEAHSLQEPYDNNSMF
YGPPQYHHQHASNLGSGMSTAPNFYVPYVNYEAPPSFLLSHGSNDAVVGVTSTEHERNAH
FMDHGFKRKSSEVIPGNSQYPVAPCSFPQLNTSETAPFSFPHFGTYPQPLDQRSVRNRAG
AATMDPLLSHGHNNFSQGNYAAHPFPPLGSIWYDQHCNGNRSDGSSSLWSQAPAVPYMHG
NIATGSIESGNVCFPRYHETSSSRNPTPSVYQRNHYISHHPVPPPPIVYPHMPSASYAET
LHPASYSHMGQVQSTGFRINQYPGEDFVPAAILRHRELPHFRAMPANENAFWEVGDFYNA
VNYVDHHQDMRLDIEDMSYEELLALSDQIGTVKTGLSSEDVKELLKRRTSTRINLEEGPS
TDLETDSCTICQENYKNEDKIATLDCMHKYHAECLKKWLVIKNVCPICKSEALVIEKKKK
LRLSSR

www.000webhost.com

Other information
Ka divergence:0.0673781KaKs divergence:0.382689
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):1485Length 2 (bp):1461Length divergence:-0.008
MFE 1 (kcal):-445.56MFE 2 (kcal):-393.77MFE divergence-0.062