Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53230-AT3G15030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 3
Function (paralog2):TCP family transcription factor 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.65252222359316
Log2 mRNA fold difference:-0.72788412147344
Log2 TE fold difference:0.11538849409603
Sequences
Protein sequence

MAPDNDHFLDSPSPPLLEMRHHQSATENGGGCGEIVEVQGGHIVRSTGRKDRHSKVCTAK
GPRDRRVRLSAPTAIQFYDVQDRLGFDRPSKAVDWLITKAKSAIDDLAQLPPWNPADTLR
QHAAAAANAKPRKTKTLISPPPPQPEETEHHRIGEEEDNESSFLPASMDSDSIADTIKSF
FPVASTQQSYHHQPPSRGNTQNQDLLRLSLQSFQNGPPFPNQTEPALFSGQSNNQLAFDS
STASWEQSHQSPEFGKIQRLVSWNNVGAAESAGSTGGFVFASPSSLHPVYSQSQLLSQRG
PLQSINTPMIRAWFDPHHHHHHHQQSMTTDDLHHHHPYHIPPGIHQSAIPGIAFASSGEF
SGFRIPARFQGEQEEHGGDNKPSSASSDSRH

MSDDQFHHPPPPSSMRHRSTSDAADGGCGEIVEVQGGHIVRSTGRKDRHSKVCTAKGPRD
RRVRLSAHTAIQFYDVQDRLGFDRPSKAVDWLIKKAKTSIDELAELPPWNPADAIRLAAA
NAKPRRTTAKTQISPSPPPPQQQQQQQQLQFGVGFNGGGAEHPSNNESSFLPPSMDSDSI
ADTIKSFFPVIGSSTEAPSNHNLMHNYHHQHPPDLLSRTNSQNQDLRLSLQSFPDGPPSL
LHHQHHHHTSASASEPTLFYGQSNPLGFDTSSWEQQSSEFGRIQRLVAWNSGGGGGATDT
GNGGGFLFAPPTPSTTSFQPVLGQSQQLYSQRGPLQSSYSPMIRAWFDPHHHHQSISTDD
LNHHHHLPPPVHQSAIPGIGFASGEFSSGFRIPARFQGQEEEQHDGLTHKPSSASSISRH

Other information
Ka divergence:-0.00540126KaKs divergence:0.469528
GC content 1 (%):48GC content 2 (%):53GC content divergence:0.05
Length 1 (bp):1176Length 2 (bp):1263Length divergence:0.036
MFE 1 (kcal):-356.04MFE 2 (kcal):-425.06MFE divergence0.088