Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53240-AT3G15020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Lactate/malate dehydrogenase family protein
Function (paralog2):Lactate/malate dehydrogenase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.7710235547992
Log2 mRNA fold difference:-3.3134574117718
Log2 TE fold difference:0.52020800035646
Sequences
Protein sequence

MFRSMLVRSSASAKQAVIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL
YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN
INAGIVKNLCTAIAKYCPHALINMISNPVNSTVPIAAEIFKKAGMYDEKKLFGVTTLDVV
RARTFYAGKANVPVAEVNVPVIGGHAGVTILPLFSQATPQANLSSDILTALTKRTQDGGT
EVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVIECSYVQSTITELPFFASKVRLG
KNGVEEVLDLGPLSDFEKEGLEALKPELKSSIEKGVKFANQ

MFRSMIVRSASPVKQGLLRRGFASESVPDRKVVILGAAGGIGQPLSLLMKLNPLVSSLSL
YDIANTPGVAADVGHINTRSQVSGYMGDDDLGKALEGADLVIIPAGVPRKPGMTRDDLFN
INAGIVKNLSIAIAKYCPQALVNMISNPVNSTVPIAAEIFKKAGTYDEKKLFGVTTLDVV
RARTFYAGKSDVNVAEVNVPVVGGHAGITILPLFSQASPQANLSDDLIRALTKRTQDGGT
EVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPNVVECSFVQSTITELPFFASKVRLG
KNGVEEVLDLGPLSDFEKEGLEALKAELKSSIEKGIKFANQ

www.000webhost.com

Other information
Ka divergence:0.0377506KaKs divergence:-0.0714722
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1026Length 2 (bp):1026Length divergence:0
MFE 1 (kcal):-334.62MFE 2 (kcal):-338.5MFE divergence0.006