Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53280-AT3G14990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Class I glutamine amidotransferase-like superfamily protein
Function (paralog2):Class I glutamine amidotransferase-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.7541424646245
Log2 mRNA fold difference:1.6613045120169
Log2 TE fold difference:0.085469468494846
Sequences
Protein sequence

MASSSLCHRYFNKITVTPFFNTKKLHHYSPRRISLRVNRRSFSISATMSSSTKKVLIPVA
HGTEPFEAVVMIDVLRRGGADVTVASVENQVGVDACHGIKMVADTLLSDITDSVFDLIML
PGGLPGGETLKNCKPLEKMVKKQDTDGRLNAAICCAPALAFGTWGLLEGKKATCYPVFME
KLAACATAVESRVEIDGKIVTSRGPGTTMEFSVTLVEQLLGKEKAVEVSGPLVMRPNPGD
EYTITELNQVSWSFEGTPQILVPIADGSEEMEAVAIIDVLKRAKANVVVAALGNSLEVVA
SRKVKLVADVLLDEAEKNSYDLIVLPGGLGGAEAFASSEKLVNMLKKQAESNKPYGAICA
SPALVFEPHGLLKGKKATAFPAMCSKLTDQSHIEHRVLVDGNLITSRGPGTSLEFALAIV
EKFYGREKGLQLSKATLV

MASFTKTVLIPIAHGTEPLEAVAMITVLRRGGADVTVASVETQVGVDACHGIKMVADTLL
SDITDSVFDLIVLPGGLPGGETLKNCKSLENMVKKQDSDGRLNAAICCAPALALGTWGLL
EGKKATGYPVFMEKLAATCATAVESRVQIDGRIVTSRGPGTTIEFSITLIEQLFGKEKAD
EVSSILLLRPNPGEEFTFTELNQTNWSFEDTPQILVPIAEESEEIEAIALVDILRRAKAN
VVIAAVGNSLEVEGSRKAKLVAEVLLDEVAEKSFDLIVLPGGLNGAQRFASCEKLVNMLR
KQAEANKPYGGICASPAYVFEPNGLLKGKKATTHPVVSDKLSDKSHIEHRVVVDGNVITS
RAPGTAMEFSLAIVEKFYGREKALQLGKATLV

Other information
Ka divergence:0.489798KaKs divergence:0.199104
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1317Length 2 (bp):1179Length divergence:-0.055
MFE 1 (kcal):-412.78MFE 2 (kcal):-371.2MFE divergence-0.053