Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53290-AT3G14960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactosyltransferase family protein
Function (paralog2):Galactosyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.75124564776355
Log2 mRNA fold difference:0.29525231804939
Log2 TE fold difference:-1.115674020766
Sequences
Protein sequence

MHSPRKLFHARSSLATRRSTALVVLTSLAIGIAGFTFGLAVILIPGLRLTGRNCLTNTPP
KTVRVVWDVAGNSNGVVSGEKKRHKVMGFVGIQTGFGSAGRRRSLRKTWMPSDPEGLRRL
EESTGLAIRFMIGKTKSEEKMAQLRREIAEYDDFVLLDIEEEYSKLPYKTLAFFKAAYAL
YDSEFYVKADDDIYLRPDRLSLLLAKERSHSQTYLGCLKKGPVFTDPKLKWYEPLSHLLG
KEYFLHAYGPIYALSADVVASLVALKNNSFRMFNNEDVTIGAWMLAMNVNHENHHILCEP
ECSPSSVAVWDIPKCSGLCNPEKRMLELHKQESCSKSPTLPSDDE

MSSSPKLFHARPSFFTRRSTPLIVFTSLAIGLTGFLFGLSTILFPGLRLSGRSCLTNLPP
KTVKIVWDVAGNSIVNGEVKRHKVMGFVGIQTGFRSAGRRRALRNTWMPSDPEGLRRLEE
STGLAIRFIIGKTKDEAKMVELRSEVAMYDDFILLDIEEEYSKLPYKTLAFFKAAYALYD
SEFYVKADDDIYLRPDRLSLLLAKERGHSQTYLGCMKKGPVFTDPKLKWYEPLADLLGKE
YFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLAMNVNHENLHTLCEPEC
SPYSIAVWDIPKCSGLCNPEKRMLELHMLESCSKSPTLPSDDE

www.000webhost.com

Other information
Ka divergence:0.130638KaKs divergence:0.0392435
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1038Length 2 (bp):1032Length divergence:-0.003
MFE 1 (kcal):-313.14MFE 2 (kcal):-310.3MFE divergence-0.005