Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53310-AT3G14940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phosphoenolpyruvate carboxylase 1
Function (paralog2):phosphoenolpyruvate carboxylase 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.0024803627161816
Log2 mRNA fold difference:0.14136843387707
Log2 TE fold difference:-0.12515142813179
Sequences
Protein sequence

MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL
YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK
KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAATMYFNQIEDLMFEMSMWRCNDELRARADEVHANSRKDAAKHYIEFWKS
IPTTEPYRVILGDVRDKLYHTRERAHQLLSNGHSDVPVEATFINLEQFLEPLELCYRSLC
SCGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTHLDIGSYREWSEE
RRQEWLLSELSGKRPLFGSDLPKTEEIADVLDTFHVIAELPADSFGAYIISMATAPSDVL
AVELLQRECRVKQPLRVVPLFEKLADLEAAPAAVARLFSVDWYKNRINGKQEVMIGYSDS
GKDAGRLSAAWQLYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
NGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALLDEMAVVA
TEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGSAIRHVIEKDVRNLHMLQDMYQHWPFFRVTIDLIEMVFAKGDPGIAALY
DKLLVSEELWPFGEKLRANFEETKKLILQTAGHKDLLEGDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDPSYHVTLRPHISKEIAESSKPAKELIELNPTSEYAPGLEDTLILTMKGIA
AGLQNTG

MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL
YELSAEYEGKREPSKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK
KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYYNQIENLMFELSMWRCTDEFRVRADELHRNSRKDAAKHYIEFWKT
IPPTEPYRVILGDVRDKLYHTRERSRQLLSNGISDIPEEATFTNVEQFLEPLELCYRSLC
SCGDSPIADGSLLDFLRQVSTFGLSLVRLDIRQESERHTDVLDAITKHLDIGSSYRDWSE
EGRQEWLLAELSGKRPLFGPDLPKTEEISDVLDTFKVISELPSDCFGAYIISMATSPSDV
LAVELLQRECHVKNPLRVVPLFEKLADLEAAPAAVARLFSIDWYKNRINGKQEVMIGYSD
SGKDAGRLSAAWELYKAQEELVKVAKKYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDT
VNGSLRVTVQGEVIEQSFGEAHLCFRTLQRFTAATLEHGMNPPISPKPEWRALLDEMAVV
ATEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQ
TRFHLPVWLGFGAAFRYAIKKDVRNLHMLQDMYKQWPFFRVTIDLIEMVFAKGDPGIAAL
YDKLLVSEDLWAFGEKLRANFDETKNLVLQTAGHKDLLEGDPYLKQRLRLRDSYITTLNV
CQAYTLKRIRDANYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLILTMKGI
AAGLQNTG

www.000webhost.com

Other information
Ka divergence:0.033363KaKs divergence:0.324201
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):2904Length 2 (bp):2907Length divergence:0.001
MFE 1 (kcal):-952.45MFE 2 (kcal):-942.82MFE divergence-0.005