Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53380-AT3G14870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF641)
Function (paralog2):Plant protein of unknown function (DUF641)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.32688058985141
Log2 mRNA fold difference:-1.2162833114153
Log2 TE fold difference:0.82526199791635
Sequences
Protein sequence

METVRPMVVAPKGNKLRRKFAKVLNIHKLTGVAPEGEMKKIKFDSKTAKLSESFYKLEEE
YERSQGLEALLAKLFATVSSIKAAYAQLQHSQSPYDSIGIQKADNLVVAELKTLSELKQC
FMKKQVDPNPERTLVLAEIQELRSLLKTYEIMGKKLESQYKLKDSEIIFLREKLDESMKQ
NKLTEKRLNQSGQLCNPLDNLHLSALNPTHFVTYLHHTVKSTRGFVKLMIEQMKLAGWDI
SSAANSIHPGVFYYKQDHKCFTFEHFVSNVMFEAFHLPYFSTSSESRSYKKKKQSNADRE
MFFERFKELRSMKAKDYLTARPKSRFARFCRAKYLQLIHPKMEQAFFGHLHLRNQVSAGE
FPETSLFSGFLEMAKRIWLLHCLALSFEREAEIFRVPKGCRFSEVYMKSVAEEAFFPAAE
SSPESEPRVAFTVVPGFRIGKTSIQCEVYLSLS

MNLQMESVKPLDVVSSGKGKLRRTFAKVINMKKLTGVVPEGNNKVERVKKSQEKVKLDKD
LAKNAANLSESFDKLEEEYEKRLAMEALLAKLFATISSIKSGYAQLQYAQSPYDPNGIQK
ADNLVVAELKTLSELKQSFLKKQLDPNPDRTLVLAEIQELRSVLKTYEIMGKKLECQLKL
KDSEIIFLKEKFQESMTQNKLMEKRLNQSGQLCNPLDHNLHLSAVSSTHFVTYLHHTVKS
IRGFVKLMVEQMKLAAWDIDMAAELIQPDVLYYKQDHKCFALEHYVCKIMLEAFQLPYFS
NESSKKTSREDKAMFFERFTELRSMKPREYLASRPKSRLAKFCRTKYLQLIHPKMEQAFF
GHLHQRNQVTAGEFPETSLCTAFLEMAKRVWLLHCLAFSFDPEASIFQVSRGCRFSEVYM
KSVSEEAFFSPEQEESSSETEPGVAFTVVPGFRIGKTTIQCEVYLSRSCQRRQSR

www.000webhost.com

Other information
Ka divergence:0.00539027KaKs divergence:0.135714
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1362Length 2 (bp):1428Length divergence:0.024
MFE 1 (kcal):-396.3MFE 2 (kcal):-438.05MFE divergence0.05