Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53450-AT3G14830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.1072528149544
Log2 mRNA fold difference:1.2552785164968
Log2 TE fold difference:-0.066839607100422
Sequences
Protein sequence

MSVERSLEAWEEVQRHGQDLADRLAQGFNGLIQINPPSFPSKLFDLEFSSQHFGIRDSRF
SIHQPINGVSAILDIGNKIGQAGVDFGSGLNVMVQQFFRRLPVPFRHDENVFVSTERDTV
TRSHRAYVDTKENSAFSKTDTASSGTVYEEKVTEFDLRTIGLHRRAKGTVELSSSYETRT
SSMEHSLAARGDLWRVEASTSNSPVRDDSSSLFLLQLGPLLFLRDSTLLLPVHLSKQHLL
WYGYDRKKGMHSLCPALWSKHRRWLMMSMLCLNPLDCSFVDLQFPNGQLTYVSGEGLTTS
VFVPLCGGLLQAQGQYPGDMRFSFSCKSKQGTRITPMINWPDKSLALGVSQALAWRRSGV
MLKPAIQLSVCSTFGGSNPGIKTEVIQSLNDNINMICGCAFTAHPSTFASVSFGRSKWNG
NIGRTGIVVRADTPLPNVARPSFSIQINNAFEF

MSMERSLEAWEEVQRHGQDLADRLAQGFTGLIHINPPSFPWPPNHHHLHKAKLFDLEFPT
QHFSVIKDSRFSINQPINGVTAILDIGNKIGQAGVDFGAGLNVMVQQFFRRLPIPFLHED
NNKLVVSVDGDKSTRSHRAYVITKGDLGMATERLRDSGFSKTDDTASVTMSEEEVADSYL
RAAGLLGRSKGTIDTSSSYDSRTNGMEHSLAARGDLWRVEASHSSSTASDGNSSLFLLQL
GPLLFLRDSTLLLPLHLSKQHLLWYGYDRKKGMHSLCPAIWSKHRRWLMMSMLSLNPLAC
SFMDLQFPNGQLTYVSGEGLTTSAFVPFCGGLLQAQGQYPGDMRFSYSCKNKCGTRITPM
VHWPDKSFGLDLSQPLAWRRSGLLMKPTIQVSVCPTFGGSNPGIKAEVIHSLSDDLNLIC
GYALNAHPSAFASVAFGRSKWNGNIGRTGIVVRADTPLASIGQPSFSIQLNNAFEF

www.000webhost.com

Other information
Ka divergence:-0.184655KaKs divergence:-0.265666
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1362Length 2 (bp):1431Length divergence:0.025
MFE 1 (kcal):-409.4MFE 2 (kcal):-405.08MFE divergence-0.005